LIFE IN THE ABSTRACT
Works by Laurence Young

On Exhibit: through December 8
Opening Reception: Friday, November 28 | 5:00–7:00 PM

www.Laurenceyoung.com
@laurenceyoungart

Life in the abstract Artist Statement I walk a delicate line between representation and abstraction, seeking the place where the seen dissolves into the felt. Each work begins with a point of departure, yet its destination remains a mystery, revealed only through the act of making. Color is the heartbeat of my process. Subtle shifts of closely related hues weave together, creating a quiet tension—a harmonious energy that sets the emotional tone. As layers build, the surface begins to speak, guiding me from what I know toward what I discover. The process is a conversation, a dance of presence. Each mark listens to the last and whispers to the next, sometimes asking to stay, sometimes to be erased. This rhythm of watching and responding becomes an intimate dialogue between my hand and the canvas. Inspiration comes unbidden, like a sudden breeze. I do not chase it; I simply stay open, letting it arrive in its own quiet way.

ILLUMINATING CAPE COD: A COLLECTIVE VISION
Curated by Amanda Reed

On Exhibit: through December 8
Opening Reception: Friday, November 28 | 5:00–7:00 PM

www.capecodviewfinders.com

The Cape Cod Viewfinders Camera Club is pleased to present Illuminating Cape Cod: A Collective Vision, an exhibition showcasing the artistry and vision of its members. The exhibition brings together a diverse body of work that explores the Cape’s distinctive light, landscapes, seascapes and people through the lens of local photographers.

From sweeping coastal vistas to intimate details of everyday life, these photographs reveal the richness of perspective that emerges when artists engage deeply with place. Together, they offer a collective portrait of Cape Cod—both timeless and ever-changing—inviting viewers to see the familiar in new and surprising ways.



Illuminating Cape Cod: A Collective Vision affirms the enduring power of photography not only to document, but to transform, inspire, and connect community through shared vision.
 About the Cape Cod Viewfinders Camera Club Founded in 1958, the Cape Cod Viewfinders Camera Club brings together photographers of all levels who share a passion for the art and craft of photography. Through exhibitions, workshops, guest speakers, and field trips, the club fosters artistic growth, technical knowledge, and creative exploration. Members are united by their commitment to capturing and celebrating the beauty of Cape Cod and beyond, while building a supportive community of image-makers.

Outer Cape Art Collective: Light in Darkness, curated by Joe Diggs

Outer Cape Art Collective
Bobbye Cochran • Cynthia Cole • Portia Durbin • Mary Fox • Laura Frader • Debra Gold •
Marcia Hams • John Koch • Monica Mackey • Maeve M. O’Donovan • Mary Ann O’Loughlin • Anne Taylor Quarles • Laura Shabott • Dee Shippelhute • Kathryn Stearns • Betsy Higgins-Steele • Patricia Van Dijkhuizen • Anne Webb-Johnson • Sondra Weiner

November 12- November 23, 2024
Opening Reception: Friday November 14, 5-7 pm
The Commons 46 Bradford Street Provincetown, MA 02657

“Light in Darkness” is the Fall exhibit of the Outer Cape Art Collective (OCAC), a group
of artists, who came together during three years of learning from and experimenting with
artists and educators Laura Shabott and Alana Barrett.

Members of the Collective present an exciting, diverse range of styles, inspired by the
prompts of their teachers and members, by the Outer Cape’s long tradition of
abstraction, its light and landscape, as well as by our travels, friends, and family.

Working together during the pandemic, most are now full-time artists who have
distinguished themselves in diverse professional lives, as doctors, architects,
journalists, scholars and educators, writers, and business leaders. All share a passion
for painting. Members of OCAC exhibit their work in galleries and shows nationally as
well as on the Outer Cape.

OF THE SEA
Works by Marisa Picariello

On Exhibit: through November 23
Opening Reception: Friday, November 14 | 5:00–7:00 PM

www.marisapicariello.com
@MarisaPic

Along the shores of the ocean is a wealth of inspiration; the forms of a seashell, the solitude of a winter walk, the waves and how we interact with them, and the ever changing landscape.

LIFE IN TECHNICOLOR
Works by Brad Mitchell

On Exhibit: through November 10
Opening Reception: Friday, October 31 | 5:00–7:00 PM

bradmitchell202@gmail.com
@leggo__the__ego

I am an Outer Cape artist who, like many, came to Cape Cod for a respite from city life…and never left. I uprooted a longtime existence in Washington, DC for the Outer Cape and its surreal landscape, expansive shorelines, and magical sky. 

My work is focused on translating onto canvas the energy, love, and magic I feel as I walk in the woods, the dunes, and along the bay and ocean shorelines, all while being mesmerized by the Cape’s big, beautiful, ever-changing sky. 

If I had to sum up my work in three words, they would be: Life in technicolor.

PADRIC AND MICHAEL: THE FIRST 50 YEARS
Works by Padric Meagher and Michael Guy

On Exhibit: through November 10
Opening Reception: Friday, October 31 | 5:00–7:00 PM

PADRIC MEAGHER: Why read this instead of perusing the “art”? Call with questions —
401-573-5379. Thanks.

pmmrealestate@gmail.com

MICHAEL GUY: Just for fun, in 1979, I asked a friend to take a snapshot of me at the beach wearing a red bikini and a paper cutout of Santa Claus’ face as a mask. I made a few prints for friends as Christmas cards, never imagining that for 45 years I would be wracking my brain every year to come up with a new goofy idea for celebrating the holidays. Other than the fourth card in 1982 or the Smackdown audience in 2016, I’m the only person — or all the people — in the photos, which have been taken by friends, my husband Padric, or often by myself. Frequent collaborators are my friends Frosty and Rudolph. Though Photoshop has proven useful in recent years for a little assistance — and it’s pretty obvious when I’ve used it — I was really there at those locations in those costumes with those props. Happy holidays!

trinityartguy@gmail.com

THE WAVE FUNCTION BY ANTONY KIRMAN

On Exhibit: through November 10
Opening Reception: Friday, October 31 | 5:00–7:00 PM

www.LOS.org

These paintings represent work from the past 3 years, originally inspired by a  wonderful abstract painting class taught by Sky Power at PAAM. Before that my approach to color was photographic - grading colors and tones both chemically and digitally. Now the freedom of painting enables me to feel the color instead of ‘dealing with it’.  The works are happiness spells, Dhamma diagrams of feeling-gestures. When the maps become so large that they smother reality (Borges et al.), we can follow the music and color to create a better world.

I have lived on Cape Cod in Eastham for eight years and sell my art prints, photographs, and paintings at the Art Cottages in Orleans every summer. My work has been featured in group shows at PAAM and The Cordial Eye in Hyannis. This year, I moved into my first studio here in Provincetown at Shank Painter The Studios.

METAL MANIA REDUX BY MARGOT STAGE

Opening Reception: Friday, October 17 from 5 - 7 PM

On Exhibit through October 26
The Commons
46 Bradford Street, Provincetown

margotstage.com

My passion for “road metal” defies explanation. Rusty, mangled, flattened fragments of metal catch my eye and I can’t resist picking them up for my 20+ year collection. Many are old automobile parts -- the heat shield for a catalytic converter, the curve of a brake drum. Others are worn and re-shaped beyond recognition into lacy and scratched pieces — corroded and marked by time and weather. Not every bit of metal has come from the road. I found a lovely piece in a redwood forest in California; a bright blue piece of an old school locker in a scrap yard; a majestic scalloped circle fell off the bottom of a trash can beside a high school football field. This body of work has been created entirely without welding. I use wire, pop rivets, gravity and glue to assemble the pieces into sculptural forms. The material itself — the individual pieces — dictate the direction far more than my mind does. There are often delightful surprises, and sometimes crashing frustrations that need to be solved. I also use pieces of found metal to create series of mono prints. Metal Mania Redux raises several questions. Do we recognize beauty in deterioration and decay? Can we appreciate the marks that time and nature make on materials, as well as on ourselves? Will we bear witness to obsolescence and endless change?

SHADES OF GHEY BY JUSTINE CROSBY

Opening Reception: Friday, October 17 from 5 - 8 PM
On Exhibit through October 26
The Commons
46 Bradford Street, Provincetown

@shadesofghey

Art is the language that I use to contemplate the seen and the unseen. With a lifelong interest in both drawing & dance, I studied illustration in Savannah at SCAD, then received my BFA in Boston at MassArt. I have also performed on various stages in different capacities around the country. As a visual artist and a performance artist, I have connections in both fine art, illustration, dance, costume, makeup, and hair. I’ve worked in paper, paper mâché, fabric, copper wire, ink, gouache & acrylic, and mixed-media. And through these mediums, I’ve experimented in both 2-D and 3-D works, and in small to larger scale installations. My current obsession is lampshades. Specifically, bringing older lampshades a new life, in my favorite medium ~ paper. Handmade paper, vintage magazines, drawings, paintings, and sketches are all mixed together to form a one of a kind lampshade. Each shade tells a different story from every angle and the story continues to evolve depending on if the light is on or off. The possibilities feel endless.

THE LIGHT BETWEEN
WOMEN’S GROUP SHOW
Shez Arvedon · Rosalie Acinapura · Lennie Alickman · Ellen Anthony · Susan Bernstein · Alison Blake · Cid Bolduc · Karen Cappotto · Barbara E Cohen · Mary DeAngelis · Jean Fogg-Brock · Jo Hay · Catherine Hess · Grace Hopkins · Valerie Isaacs · Priscilla Jackett · Amy Kandall · Zehra Khan · Lorrie La Pointe · Dianne Longchamps · Donna Mahan · Marilyn Massad · Maureen McCarron · Kate McConnell · Diane Messinger · Karen Miller · Patte Ormsby · Donna Pomponio · Susie Rhatigan · Marian Roth · Jill Rothenberg-Simmons · Jen Rumpza · Andrea Sawyer · Laura Shabott · Emily Shiell · Elspeth Slayter · MiYoung Sohn

Opening Reception: Friday, October 17 from 5 - 7 PM

On Exhibit through October 26
The Commons
46 Bradford Street, Provincetown

Since November 2022, The Commons has been proud to host and foster conversation with our Women’s Group, a gathering of female-identifying artists on the Outer Cape. The group was formed to inspire creative endeavors, nurture community, and provide a space to share experiences and stories about sustaining an artistic practice. In a place where resources are often limited, knowledge, support, and connection become truly invaluable.

In tandem with this year’s Women’s Week (October 13–19), we are honored to present The Light Between, an exhibition that celebrates the power of expression, creativity, and voice. This show highlights the profound impact these women have on our creative community and invites you to experience their artistry firsthand.

LINES IN TIME: WHITE LINE WOODCUT GROUP SHOW
Bill Evaul, Sherry Sherwood, Lorraine Kujawa, Darrell Smith, Kathryn Lee Smith, and Julie Gray

On Exhibit: through OCTOBER 12
Opening Reception: Friday, October 3 | 5:00–7:00 PM

Lines in Time: White Line Woodcut celebrates over a century of artistic innovation rooted in the unique white-line woodblock printing technique born in Provincetown, Massachusetts. Developed around 1915 by members of the Provincetown Printers—most notably B.J.O. Nordfeldt, Ada Gilmore, and Blanche Lazzell—this method revolutionized printmaking by using a single carved block with gouged lines separating hand-painted color areas, producing a luminous watercolor-like image bordered by the signature white lines. Influenced by Japanese ukiyo-e prints and European Modernism, the Provincetown Print distilled complex traditions into an accessible and distinctly American form, often capturing the Cape’s coastal life and spirit through bold shapes, flattened perspective, and intimate subject matter.

This group exhibition brings together contemporary artists to trace the lineage and evolution of the white-line print. From early masters like Lazzell and Maud Hunt Squire to present-day practitioners including Kathryn Lee Smith, the show highlights the enduring relevance and vitality of the technique. New works honor the tactile, meditative nature of white-line printing while pushing its boundaries through abstraction, expanded palettes, and narrative experimentation. Lines in Time invites viewers to explore how this Provincetown-born art form continues to evolve—bridging past and future, tradition and reinvention—with each carved line.

PARTICIPATING ARTISTS:

Darrell Smith: Darrell Smith learned white-line woodblock printing at the Provincetown Art Association Museum (PAAM). Kathryn Lee Smith (no relation) was his first teacher, and she learned the technique from her grandmother Ferol Sibley Warthen, who learned from Blanche Lazzell. He completed the Teaching Artist Development Program at PAAM in 2022. He regularly exhibits his work as a member of the American Color Print Society. Smith's work has been shown in juried exhibitions at PAAM, The Pontiac Creative Arts Center, and at Art Wellesley. In 2020, one of his prints was selected by the jury for the 50th annual Cherokee Trail of Tears Art Show held in Tahlequah, Oklahoma. In August 2022 he was featured in a show at Julie Heller Gallery East. His first solo show at Provincetown Commons was April 2023, with another solo show at the Wellesley Free Library in May 2024.

smithprovincetownprints.com

Julie Gray: Through my prints, I try to communicate the feeling of a place through the unique and historically rich medium of white-line woodcut printmaking. Whether it’s a specific landscape, building or a random cottage, my hope is that these prints allow the viewer to connect with their memories of Provincetown in some way. This method, originally created in Provincetown in 1914, allows me to break down a composition into tangible, discrete shapes and colors to develop the image. I am deeply indebted to Kathryn Lee Smith, granddaughter of Ferol Sibley Warthen, for her guidance in teaching me this traditional technique. The physicality of carving directly into the wood block resonates with me on several levels. Each cut and gouge from the wood contributes to the defining "white line" that frames and shapes the final image. This process is both deliberate and intuitive, a conversation between my vision and the inherent qualities of the wood itself. While I also work in oil painting and watercolor, I enjoy the direct, tactile nature of white-line prints. I strive to capture not just the visual elements of a scene, but its underlying mood and atmosphere. My prints are an attempt to create a sense of familiarity and connection for the viewer, inviting them to recall their own memories or experiences of the place.

Kathryn Smith: I have been making white line prints for my entire life, learning the method from my artist grandmother, Ferol Sibley Warthen, a student of Blanche Lazzell's, when I was four years old. Working in this tradition became my life's work. My prints draw heavily on the sense of a particular moment in time, whether that moment is conveyed as a representational image or an abstraction. The formal elements of the visual language give me the tools to transform the idea; the process of manipulating these elements to support the theme bring the idea into focus. The inherent warmth of the wood, the use of hand tools, the physicality of pulling the print, all are a significant part of the process which informs the final print.

@KLSprovincetownprints
kathrynleesmithwhitelineprints.com

Lorraine Kujawa: Reflections The multitude of life here in Provincetown feeds my work. My goal is to keep looking and reflecting on the interesting and the beautiful.

lkuj34@comcast.net

Sherry Sherwood: Focusing primarily on the white-line color woodcut (Provincetown Print) for the last forty years I have developed an advanced understanding of the medium and its history. By combining analytical cubism with the vibrant colors of Impressionism, I create an easily understood abstraction through light, energy, and motion. Drawing the viewer in through active and expressive compositions transporting them into a complex experience of a certain event. Within these lines and brush work, a sense of freedom emerges from a traditionally more restrictive woodblock printmaking process.

sherrysherwood.com
@Artist4Earth

WORKS ON PAPER BY TIA SCALCIONE

On Exhibit: through OCTOBER 12
Opening Reception: Friday, October 3 | 5:00–7:00 PM

There is nothing quite as satisfying as making marks on paper, whether with ink, paint, pen or pencil. This series is composed of my daily drawings, monotype prints and ink paintings.

@tiascalcioneart

MODERNO BY FRAN O’NEILL

Opening Reception: Friday, October 3 from 5 - 7 PM
On Exhibit through October 12
The Commons
46 Bradford Street, Provincetown

@Franionptown
Franoneillartist.com

My artistic vision focuses on the connection between healing and energy. We are all energetic beings, and the wood grain in my art symbolizes this universal energy. I incorporate dynamic shapes, composition, and color to represent this energetic exchange, which allows abstract forms to integrate seamlessly with the natural wood texture. My goal is to create an intersection where the energy in the artwork, the wood, and the viewer all converge. My work is modern and mid-century inspired with a kinetic feel that resonates with the viewer.

SAME SPOT - DIFFERENT TIMES BY HANS RATH
(Land`s End from "Angel Foods")

Opening Reception: Friday, September 19 from 5 - 7 PM
On Exhibit through September 29
The Commons
46 Bradford Street, Provincetown

hansrath.com

I love to paint outside. To see the changing colors of the sky, the sea and the land is always exciting for me, especially here in Provincetown. When I start a painting at 2 pm and finish it at 4 or 5 pm, then the whole afternoon is in it. The process of painting is the real excitement. I follow the different formations of clouds and differnt  colors of the sea, changing the painting until a situation satisfies me. Going back to the same spot and paint the same view to different times over and over is for me like meditation on life itself.

A SENSE OF PLACE
THE PROVINCETOWN PHOTOGRAPHERS COLLECTIVE
Lipe Borges, Marilyn Brodwick, Rebecca Bruyn, Julia Cumes, Marty Hassell, Jeff Krehely,
Jack Lynch, Emilie Marks, Reenie Lynch Murphy, Emory Petrack, Lisa Raczka, Leland Smith, Richard White, Elizabeth G. Brooke

Opening Reception: Friday, September 19 from 5 - 7 PM

On Exhibit through September 28
The Commons
46 Bradford Street, Provincetown

The Provincetown Photographers Collective A Sense of Place In A Sense of Place, members of the Provincetown Photographers Collective explore the many ways place shapes perception, memory, and emotion. Though our collective gathers each month in Provincetown--a town long celebrated for its creative spirit--our members and our images extend far beyond its borders. Each collection in this show offers a distinct point of view--an invitation to see not only what a place looks like, but what it feels like. Some works evoke intimacy or nostalgia; others speak to displacement, transition, or wonder. Together, they remind us that a sense of place isn’t defined by location alone, but by experience, perspective, and emotional resonance. We are united by a shared belief in photography as a form of visual storytelling and creative inquiry. A Sense of Place is our collective meditation on belonging, perception, and the human instinct to anchor ourselves--in landscapes, in memory, and in each other.

Leland (Lee) Smith's photography transcends strict categories. With an intuitive eye he explores landscape, architecture and still life. His images capture a deep sensitivity for composition, light, and color. Further influenced by the evocative moods of pictorialism and the nuanced color palettes of tonalism, Smith's photographs prioritize aesthetic impact over strict realism. He often employs layered exposures and intricate textures to forge a powerful graphic dynamic, yielding images rich in complex tonality and a distinctive softness. Each final piece, regardless of its subject, reveals a striking harmony of monochromatic tranquility and subtle chromatic shifts. This refined photographic sensibility has been cultivated through his career of directing high-profile television commercials, a journey that provided him with direct access to the insights of leading advertising still photographers and legendary motion picture cinematographers. His work has been featured at The Danforth Museum; The SoHo Photo Gallery, NYC; The Griffin Museum of Photography, The New York Center for Photography; Gallery ph 21, Budapest; The Commons, Provincetown. Publications include: Musée, Lens, LensWorks and Targee Magazines. Lee splits his time Connecticut and Cape Cod.

@lelandsmithphotography
www.lelandsmithphotography.com

Emory Petrack Our society largely avoids engaging deeply with the reality of mortality. This avoidance has profound consequences, from personal lives lived without intention, to broader societal indifference and even political turmoil. Having spent my career in pediatric emergency medicine, I've intimately confronted both life's fragility and resilience. Now approaching 70, my reflections naturally gravitate toward deeper contemplations of death and its inseparable link with living fully. In A Matter of Life and Death, I explore visually what we often prefer not to acknowledge: the delicate transitions between clarity and uncertainty, presence and absence, solidity and dissolution. Through transient forms, softened edges, and quiet moments that gesture toward what lies beyond, I invite viewers into a contemplative space—one where impermanence becomes both a truth and teacher.

@epetrack
www.SoothingScapes.com

Jeff Krehely I first visited Provincetown in 2002, when I was 25 years old. Like many, I fell in love with the town’s quirkiness, history, architecture, and natural beauty and I became a frequent visitor. In late 2019 I moved here full-time. I grew up as a closeted gay kid in semi-rural/semi-suburban Pennsylvania in the 1980s and 1990s. This was a time and place that encouraged anti-gay behavior and beliefs, and I learned that I sometimes had to shrink and hide myself to stay safe. In these moments, I would notice interesting colors, light, lines, and shapes in my surroundings. After I came out of the closet as a young adult, my brain continued to notice very specific details of where I was, and I would often pause to observe them. I now use cameras to catch those scenes and images. Most of my current work is of Provincetown and the Outer Cape. I feel a sense of responsibility photographing a place that is environmentally and economically fragile. It is ever changing—the shape of the coastal edge; the height of the waves; the texture of the dunes; the density of the forests; who can afford to live and thrive here; the exterior of buildings, which take a pounding from our weather. I hope my work helps to preserve this place in some way and makes people remember—and celebrate!—why it’s worth protecting and cherishing.

@JeffKrehely
krehelyphotography.com

Lipe Borges In 2006, Lipe Borges was completely fascinated to see a photograph develop right before his eyes in the darkroom of the Social Communication college. Since then, he started carrying his camera everywhere. He has traveled to over 10 countries taking photographs, and in 2011, he founded and directed Estudio Colmeia and the school Ensino Fotografe. Over 7 years, the school graduated more than 300 students, participated in various workshops, exhibitions, photo outings, and expeditions. Lipe has explored various areas of photography such as weddings, products, fashion, and currently dedicates himself exclusively to Documentary Projects and Artist Portraits in Cape Cod. He was the first Brazilian to be awarded the Creative Futures Cape Cod fellowship in 2024 by The Cordial Eye, and selected the following year for the Teacher Artist Fellowship also by The Cordial Eye. Among more than 70 applicants, he was one of the 15 chosen for the Creative Exchange program by the Arts Foundation Cape Cod. He was also awarded the Creative Individuals Grant by the Mass Cultural Council and the Collective Imagination for Spatial Justice by the New England Foundation for the Arts. He has exhibited his work in over 15 galleries, in Brazil, Peru, and the United States.

@olipecurioso
curiouslipe.com

Elizabeth Brooke I grew up in the Hamptons on the eastern shore of Long Island, surrounded by an artistic family. My grandfather was a poet and author. My grandmother painted watercolors in her garden. My mother drew and painted. Three sisters attended art school and went on to become art therapists, printmakers, and fashion designers. So nothing led me to art. It was always there, and I thought everyone made it. I am not a terribly patient person, so photography fit me. It gave me an immediate voice. I became fascinated by the idea that I could capture someone or an animal through my lens and create something lasting longer than a glance. I could freeze time, the memory of that moment. This ability has served me well as I age, and memory has become a challenge. My history and deep connection with animals is long. As a child at seven, I was in the animal rescue business — sparrow hawks, salamanders, ducks, dogs, wild cats, etc. I have always loved animals a bit more than people. They rarely lie. Humans have also been woven through my photographic experience. It gives me joy to make a portrait of someone I admire or to capture a story from a chance encounter in the wider world. I look for moments of interaction, connection, and behavior. When I shoot, edit, and process, I am centered, happy, productive, and at peace. Photography is the tool I use to make something that will outlive me, making my legacy when I am dust. What do I hope for when you view my work? Simply that I've shared something beautiful with you—something that sparks your curiosity. When visitors come to my shows and I see that spark of interest, when they begin to see what I see, that brings me great joy. My cat concurs.

@elizabethgbrookephotography
elizabethgbrooke.com

Julia Cumes As a photographer, I’ve had the opportunity to travel widely and explore many cultures and communities through my work. Having this unique and privileged access to other lives and cultures, I try to always be respectful in my approach, capturing a sense of place and moment and conveying the humanity of the people I’m photographing. I strive to present viewers with a version of the world they may not otherwise get to see and engage them in a dialog about this extraordinary, beautiful and complex world we live in.


@juliacumes
juliacumesphoto.com

Rebecca Bruyn The Outer Cape Dunes - Year Round Watching the Outer Cape light move along the dunes, grasses and scrub pines throughout the seasons gives me a chance to find ways to express moments of solitary beauty as I drive down Route 6 into town. I am drawn to the simplicity of the shapes, the shifting sands, the unique shadows and the light that appears alongside the road in unexpected ways. Once a moment in time is caught, I then process the image through a variety of apps on my iPhone to express how I feel about the place I call home, a place of quiet mystery. Bruyn’s love of photographic imagery combines iPhone images with cyanotypes prints, or old Kodachrome slides to iPhoneography, and most recently gilded vellum prints. In 2022, her work was exhibited at the Provincetown Art Association and Museum along with two other cyanotype artists, entitled “Out of the Blue”. In addition, she has exhibited her work at Truro Center for the Arts at Castle Hill, The Provincetown Commons, Cotuit Center for the Arts, Cape Cod Museum of Art, Cape Cod Art Association, The Creative Arts Center in Chatham, the Soho Photo Gallery in New York City and the 2017 Mira Mobile Exhibition EARTH in Porto, Portugal. She has been the recipient of several awards, including, in 2010, the winner of the Provincetown 100th anniversary of Pilgrim Monument wine label competition. Since 2016, she has been teaching “The Art of iPhoneography” at Castle Hill, PAAM, New Art Center in Newton, MA, and in private home gatherings.


@Rebecca-Bruyn
www.rebeccabruyn.com

Richard White In my wildlife photography (almost exclusively birds), I hope to capture the startling beauty and wonder of the natural world, especially those moments seldom seen. A telephoto lens permits close observation, and with endless patience (and a fair amount of luck) it is possible to record intimate interactions between birds and their environments.

Lisa Raczka The World Outside Your Door I fell in love with photography at the age of 16. I began to see the world ina different way, I was able to view everything from the tiniest of creatures to the vastness of the Milky Way. I am drawn to capture macro, landscape, intentional camera movement, animals, birds and the night sky. Cape Cod is my canvas, but I have no strings. Wherever I am in the world, I walk out the door ready to Capeture the moment. I am in love with the beauty of the natural world. Now that I am retired (not really) from being a middle school counselor for 40 years, my photography reminds me to slow down and appreciate everything around me. The beauty that surrounds us is right outside our door. Carpe Diem !

@capeturethemoment

Reenie Murphy A Sense of Place - Most of my adult life has included having a camera nearby, but the switch to digital photography was a game changer for me. Photography is part of my daily life and both capturing what is in front of me and the creative process of making images become art bring me equal joy. My time is split between Chatham, Massachusetts and Delray Beach, Florida – two beautiful spots where I can immerse myself in environments that offer a quiet place in a chaotic world. What moves me is always right in my backyard! Whether it's shifting light on the beach, intricate patterns of a flower, or the thrill of watching nesting birds raise a family, I strive to capture these moments in time. For me, nothing says Cape Cod more than hydrangeas in summer. From July through September, these beauties grace the landscape from Sandwich to Provincetown. No two petals are alike, and I love getting up close to view the many patterns and pallets on display. Each image chosen for this exhibit is a simple view of being present in nature and a visual diary of how I choose to spend my summer days – immersed, observing, and connecting. To purchase photography, please contact me at: Phone: 617-838-9686
Email: Reenie.murphy@comcast.net

@Reenie.Murphy

Marilyn Brodwick The photographs in this show explore themes of solitude, mystery, and the quiet poetry of place. An uninhabited ferris wheel is reflected in a newly created pool after a storm in Santa Monica. A lone man in a hat walks into the distance under a clouded sky. The path is unknown, the beach landscape, understated. A swing, strangely suspended in the toxic waters of Bombay Beach, part art installation and part a relic of playfulness becomes surreal and desolate. At First Encounter Beach, birds spiral in the sky with their mirrored images below in pools of water. Each scene is grounded in reality, yet tinged with ambiguity—inviting viewers to pause, wonder, and interpret. Marilyn began photographing as a teenager in Los Angeles drawn to finding interesting people on the street. Later in Galveston, Texas she taught photography for the Osher Lifelong Learning Institute (OLLI), ran a photography business, and worked as an epidemiology researcher at the University of Texas Medical Branch. Her role at UTMB eventually merged science and art when her photography became part of the institution’s outreach—resulting in two published books, Faces of Aging I and II. Marilyn’s work has been recognized with fellowships and awards including from the Houston Center for Photography and Rice University, and is in permanent museum collections such as the Museum of Fine Arts, Houston. She now divides her time between Cape Cod and Los Angeles, continuing to photograph wherever the light calls her and is known for constantly saying, “Just look at the light!”

Marbrodwick@gmail.com
@marilynbrodwick

A PLACE I’VE NEVER BEEN BY SUSAN FRANKL

Opening Reception: Friday, September 19 from 5 - 7 PM
On Exhibit through September 29
The Commons
46 Bradford Street, Provincetown

@susanfrankl.art
susanfrankl@me.com

Through the lens of my fascination with color, patterns and textures, the paintings are created using acrylic paint employing layering techniques often incorporating gold leaf, charcoal, ink pencils and collage. It begins without a roadmap or objective, but with each mark it winds its way to resolution. Images may loosely be informed by the dunes, grasses, and beaches of the Outer Cape as well as my travels to unique landscapes around the world. In my paintings you may find references to the land, water, sky and light.

The paintings emerge from an intuitive process linked to a place of deep connection to nature and self. As a physician and educator, my best work happened when I could tap into my intuitive awareness to use in concert with medical knowledge to build connection to others. As an artist, when I can immerse myself in the act of creating and allow judgement to step aside, I connect to a place of wholeness and wonder. It is then that I create my best work. I aspire to have the work similarly forge connection, sparking curiosity and joy in the viewer.