The Commons offers exhibition spaces for Outer Cape artists to show their work. We also host a variety of community events and classes that we invite all of you to attend. To keep updated on future events at The Commons, please join our mailing list or scroll down to see what is happening.
CALENDAR
OF EVENTS
CUBA BY MARCIA GEIER
CUBA BY MARCIA GEIER
Opening Reception: Friday, September 5 from 5 - 7 PM
On Exhibit through September 15
The Commons
46 Bradford Street, Provincetown
m.h. geier photography
Artist Statement
You might ask, “Why photography?” For as long as I can remember I have carried a camera. From my Kodak Brownie to my Sony digital, the intent has remained the same: to document whatever reality surrounds me. As a self taught photographer I have struggled with issues of legitimacy as an artist. I have taken solace from a wonderful quote by the choreographer Martha Graham regarding the question of a creative life: “There is a vitality, a life force, an energy, a quickening that is translated through you into action, and because there is only one of you in all of time, this expression is unique. And if you block it, it will never exist through any other medium and it will be lost."
BREAKWATER SAINTS BY BETH FAHERTY
BREAKWATER SAINTS
BY BETH FAHERTY
On Exhibit: through September 14
Opening Reception:
Friday, September 5 | 5:00–7:00 PM
Where:
The Commons
46 Bradford Street
Provincetown
@nantucketedge
My work begins at the breakwater—where the sky feels endless, the tide keeps its rhythm, and birds carry both awkwardness and majesty in equal measure. Out there, I’ve laughed, I’ve cried, I’ve turned up the music so loud it drowned out everything but the moment. What I find in those in-between spaces is resilience, humor, and beauty. The creatures I watch—sometimes graceful, sometimes clumsy—remind me of our own ways of just “handling our business.” My paintings are a way of honoring that raw honesty, transforming it into color and form, and offering it back as a kind of love letter to the Cape’s wild spirit.
WHEN ART MEETS TECHNOLOGY BY CARLOS CAICEDO
BARN BY CARLOS CAICEDO
Opening Reception: Friday, September 5 from 5 - 7 PM
On Exhibit through September 15
The Commons
46 Bradford Street, Provincetown
@Carlos-Caicedo-16
https://www.glasscanvas.com
Artist Statement
I have a lifelong interest in art and technology. My engineering profession and expertise enable me to seamlessly incorporate technology into my artistic endeavors. With conventional media, I have painted using oils, monoprints, and watercolors, but more recently, I have focused on pastels. I began incorporating computers into my work as soon as they became available. Paint software, 3D modeling and algorithms introduce innovative creative methods and effects. My paintings feature subjects such as landscapes, flowers, abstracts, and various other themes. For this show, I am featuring prints of digital paintings and hand painted pastels.
PICTURE DAY BY KAREN MILLER
PICTURE DAY BY KAREN MILLER
Opening Reception: Friday, September 5 from 5 - 7 PM
On Exhibit through September 14
The Commons
46 Bradford Street, Provincetown
Miller is a working artist based in Provincetown, Massachusetts. She is currently a resident artist at The Commons Community Studios at 74 Shankpainter. Miller studied at the Museum School in Boston, Massachusetts. She has shown her work on the Outer Cape at DNA Gallery, The Provincetown Commons, the Provincetown Art Association and Museum, AM Zehnder Gallery, and the Four Eleven Gallery. Miller participated in a three-person Emerging Artist show presented by PAAM and curated by Barbara Cohen in 1998.Karen Miller is a working artist based in Provincetown. Miller studied at the Museum School and has shown her work on the Outer Cape since 1992 at DNA Gallery, Four Eleven Gallery and is currently a resident artist at The Commons Community Studios. Miller participated in a three-person Emerging Artist show presented by PAAM and curated by Barbara Cohen in 1998
Her current body of work focuses primarily on women, and their relationships with each other and with power. She also finds ways to depict the strength, confidence and independence women draw from their bonds of friendship.
The small portrait pieces in this show are a part of her daily practice. What attracts her to these "school" photos is how they the uninhibited awkwardness of being a kid.
MAKING LIGHT
Making Light: A Conversation with Artists on Sustaining Creativity, Courage, and Connection in Difficult Times
Location: THE COMMONS
Presented by Jeannette de Beauvoir
Panelists: Susan Lambert, Myra Kooy, Art Devine, and Jay Critchley
In times of darkness, artists make light.
If you’ve been feeling overwhelmed, unheard, or disconnected—join us for an open conversation with artists who are asking the same questions and continuing to create in the face of it all.
This panel will explore:
How artists sustain their practices during challenging times
The role of creativity in building resilience and connection
Ways to nurture courage and artistic voice when the world feels heavy
This is not just a panel—it’s an invitation to share, reflect, and engage in a dialogue about what it means to be an artist now, and how we can continue making light together.
✨ Come for inspiration. Stay for connection. Leave with renewed creative energy.
A PLACE I’VE NEVER BEEN BY SUSAN FRANKL
A PLACE I’VE NEVER BEEN BY SUSAN FRANKL
Opening Reception: Friday, September 19 from 5 - 7 PM
On Exhibit through September 29
The Commons
46 Bradford Street, Provincetown
@susanfrankl.art
susanfrankl@me.com
Through the lens of my fascination with color, patterns and textures, the paintings are created using acrylic paint employing layering techniques often incorporating gold leaf, charcoal, ink pencils and collage. It begins without a roadmap or objective, but with each mark it winds its way to resolution. Images may loosely be informed by the dunes, grasses, and beaches of the Outer Cape as well as my travels to unique landscapes around the world. In my paintings you may find references to the land, water, sky and light.
The paintings emerge from an intuitive process linked to a place of deep connection to nature and self. As a physician and educator, my best work happened when I could tap into my intuitive awareness to use in concert with medical knowledge to build connection to others. As an artist, when I can immerse myself in the act of creating and allow judgement to step aside, I connect to a place of wholeness and wonder. It is then that I create my best work. I aspire to have the work similarly forge connection, sparking curiosity and joy in the viewer.
A SENSE OF PLACE, THE PROVINCETOWN PHOTOGRAPHERS COLLECTIVE
A SENSE OF PLACE
THE PROVINCETOWN PHOTOGRAPHERS COLLECTIVE
Lipe Borges, Marilyn Brodwick, Rebecca Bruyn, Julia Cumes, Marty Hassell, Jeff Krehely,
Jack Lynch, Emilie Marks, Reenie Lynch Murphy, Emory Petrack, Lisa Raczka, Leland Smith, Richard White, Elizabeth G. Brooke
Opening Reception: Friday, September 19 from 5 - 7 PM
On Exhibit through September 28
The Commons
46 Bradford Street, Provincetown
The Provincetown Photographers Collective A Sense of Place In A Sense of Place, members of the Provincetown Photographers Collective explore the many ways place shapes perception, memory, and emotion. Though our collective gathers each month in Provincetown--a town long celebrated for its creative spirit--our members and our images extend far beyond its borders. Each collection in this show offers a distinct point of view--an invitation to see not only what a place looks like, but what it feels like. Some works evoke intimacy or nostalgia; others speak to displacement, transition, or wonder. Together, they remind us that a sense of place isn’t defined by location alone, but by experience, perspective, and emotional resonance. We are united by a shared belief in photography as a form of visual storytelling and creative inquiry. A Sense of Place is our collective meditation on belonging, perception, and the human instinct to anchor ourselves--in landscapes, in memory, and in each other.
Leland (Lee) Smith's photography transcends strict categories. With an intuitive eye he explores landscape, architecture and still life. His images capture a deep sensitivity for composition, light, and color. Further influenced by the evocative moods of pictorialism and the nuanced color palettes of tonalism, Smith's photographs prioritize aesthetic impact over strict realism. He often employs layered exposures and intricate textures to forge a powerful graphic dynamic, yielding images rich in complex tonality and a distinctive softness. Each final piece, regardless of its subject, reveals a striking harmony of monochromatic tranquility and subtle chromatic shifts. This refined photographic sensibility has been cultivated through his career of directing high-profile television commercials, a journey that provided him with direct access to the insights of leading advertising still photographers and legendary motion picture cinematographers. His work has been featured at The Danforth Museum; The SoHo Photo Gallery, NYC; The Griffin Museum of Photography, The New York Center for Photography; Gallery ph 21, Budapest; The Commons, Provincetown. Publications include: Musée, Lens, LensWorks and Targee Magazines. Lee splits his time Connecticut and Cape Cod.
@lelandsmithphotography
www.lelandsmithphotography.com
Emory Petrack Our society largely avoids engaging deeply with the reality of mortality. This avoidance has profound consequences, from personal lives lived without intention, to broader societal indifference and even political turmoil. Having spent my career in pediatric emergency medicine, I've intimately confronted both life's fragility and resilience. Now approaching 70, my reflections naturally gravitate toward deeper contemplations of death and its inseparable link with living fully. In A Matter of Life and Death, I explore visually what we often prefer not to acknowledge: the delicate transitions between clarity and uncertainty, presence and absence, solidity and dissolution. Through transient forms, softened edges, and quiet moments that gesture toward what lies beyond, I invite viewers into a contemplative space—one where impermanence becomes both a truth and teacher.
@epetrack
www.SoothingScapes.com
Jeff Krehely I first visited Provincetown in 2002, when I was 25 years old. Like many, I fell in love with the town’s quirkiness, history, architecture, and natural beauty and I became a frequent visitor. In late 2019 I moved here full-time. I grew up as a closeted gay kid in semi-rural/semi-suburban Pennsylvania in the 1980s and 1990s. This was a time and place that encouraged anti-gay behavior and beliefs, and I learned that I sometimes had to shrink and hide myself to stay safe. In these moments, I would notice interesting colors, light, lines, and shapes in my surroundings. After I came out of the closet as a young adult, my brain continued to notice very specific details of where I was, and I would often pause to observe them. I now use cameras to catch those scenes and images. Most of my current work is of Provincetown and the Outer Cape. I feel a sense of responsibility photographing a place that is environmentally and economically fragile. It is ever changing—the shape of the coastal edge; the height of the waves; the texture of the dunes; the density of the forests; who can afford to live and thrive here; the exterior of buildings, which take a pounding from our weather. I hope my work helps to preserve this place in some way and makes people remember—and celebrate!—why it’s worth protecting and cherishing.
@JeffKrehely
krehelyphotography.com
Lipe Borges In 2006, Lipe Borges was completely fascinated to see a photograph develop right before his eyes in the darkroom of the Social Communication college. Since then, he started carrying his camera everywhere. He has traveled to over 10 countries taking photographs, and in 2011, he founded and directed Estudio Colmeia and the school Ensino Fotografe. Over 7 years, the school graduated more than 300 students, participated in various workshops, exhibitions, photo outings, and expeditions. Lipe has explored various areas of photography such as weddings, products, fashion, and currently dedicates himself exclusively to Documentary Projects and Artist Portraits in Cape Cod. He was the first Brazilian to be awarded the Creative Futures Cape Cod fellowship in 2024 by The Cordial Eye, and selected the following year for the Teacher Artist Fellowship also by The Cordial Eye. Among more than 70 applicants, he was one of the 15 chosen for the Creative Exchange program by the Arts Foundation Cape Cod. He was also awarded the Creative Individuals Grant by the Mass Cultural Council and the Collective Imagination for Spatial Justice by the New England Foundation for the Arts. He has exhibited his work in over 15 galleries, in Brazil, Peru, and the United States.
@olipecurioso
curiouslipe.com
Elizabeth Brooke I grew up in the Hamptons on the eastern shore of Long Island, surrounded by an artistic family. My grandfather was a poet and author. My grandmother painted watercolors in her garden. My mother drew and painted. Three sisters attended art school and went on to become art therapists, printmakers, and fashion designers. So nothing led me to art. It was always there, and I thought everyone made it. I am not a terribly patient person, so photography fit me. It gave me an immediate voice. I became fascinated by the idea that I could capture someone or an animal through my lens and create something lasting longer than a glance. I could freeze time, the memory of that moment. This ability has served me well as I age, and memory has become a challenge. My history and deep connection with animals is long. As a child at seven, I was in the animal rescue business — sparrow hawks, salamanders, ducks, dogs, wild cats, etc. I have always loved animals a bit more than people. They rarely lie. Humans have also been woven through my photographic experience. It gives me joy to make a portrait of someone I admire or to capture a story from a chance encounter in the wider world. I look for moments of interaction, connection, and behavior. When I shoot, edit, and process, I am centered, happy, productive, and at peace. Photography is the tool I use to make something that will outlive me, making my legacy when I am dust. What do I hope for when you view my work? Simply that I've shared something beautiful with you—something that sparks your curiosity. When visitors come to my shows and I see that spark of interest, when they begin to see what I see, that brings me great joy. My cat concurs.
@elizabethgbrookephotography
elizabethgbrooke.com
Julia Cumes As a photographer, I’ve had the opportunity to travel widely and explore many cultures and communities through my work. Having this unique and privileged access to other lives and cultures, I try to always be respectful in my approach, capturing a sense of place and moment and conveying the humanity of the people I’m photographing. I strive to present viewers with a version of the world they may not otherwise get to see and engage them in a dialog about this extraordinary, beautiful and complex world we live in.
@juliacumes
juliacumesphoto.com
Rebecca Bruyn The Outer Cape Dunes - Year Round Watching the Outer Cape light move along the dunes, grasses and scrub pines throughout the seasons gives me a chance to find ways to express moments of solitary beauty as I drive down Route 6 into town. I am drawn to the simplicity of the shapes, the shifting sands, the unique shadows and the light that appears alongside the road in unexpected ways. Once a moment in time is caught, I then process the image through a variety of apps on my iPhone to express how I feel about the place I call home, a place of quiet mystery. Bruyn’s love of photographic imagery combines iPhone images with cyanotypes prints, or old Kodachrome slides to iPhoneography, and most recently gilded vellum prints. In 2022, her work was exhibited at the Provincetown Art Association and Museum along with two other cyanotype artists, entitled “Out of the Blue”. In addition, she has exhibited her work at Truro Center for the Arts at Castle Hill, The Provincetown Commons, Cotuit Center for the Arts, Cape Cod Museum of Art, Cape Cod Art Association, The Creative Arts Center in Chatham, the Soho Photo Gallery in New York City and the 2017 Mira Mobile Exhibition EARTH in Porto, Portugal. She has been the recipient of several awards, including, in 2010, the winner of the Provincetown 100th anniversary of Pilgrim Monument wine label competition. Since 2016, she has been teaching “The Art of iPhoneography” at Castle Hill, PAAM, New Art Center in Newton, MA, and in private home gatherings.
@Rebecca-Bruyn
www.rebeccabruyn.com
Richard White In my wildlife photography (almost exclusively birds), I hope to capture the startling beauty and wonder of the natural world, especially those moments seldom seen. A telephoto lens permits close observation, and with endless patience (and a fair amount of luck) it is possible to record intimate interactions between birds and their environments.
Lisa Raczka The World Outside Your Door I fell in love with photography at the age of 16. I began to see the world ina different way, I was able to view everything from the tiniest of creatures to the vastness of the Milky Way. I am drawn to capture macro, landscape, intentional camera movement, animals, birds and the night sky. Cape Cod is my canvas, but I have no strings. Wherever I am in the world, I walk out the door ready to Capeture the moment. I am in love with the beauty of the natural world. Now that I am retired (not really) from being a middle school counselor for 40 years, my photography reminds me to slow down and appreciate everything around me. The beauty that surrounds us is right outside our door. Carpe Diem !
@capeturethemoment
Reenie Murphy A Sense of Place - Most of my adult life has included having a camera nearby, but the switch to digital photography was a game changer for me. Photography is part of my daily life and both capturing what is in front of me and the creative process of making images become art bring me equal joy. My time is split between Chatham, Massachusetts and Delray Beach, Florida – two beautiful spots where I can immerse myself in environments that offer a quiet place in a chaotic world. What moves me is always right in my backyard! Whether it's shifting light on the beach, intricate patterns of a flower, or the thrill of watching nesting birds raise a family, I strive to capture these moments in time. For me, nothing says Cape Cod more than hydrangeas in summer. From July through September, these beauties grace the landscape from Sandwich to Provincetown. No two petals are alike, and I love getting up close to view the many patterns and pallets on display. Each image chosen for this exhibit is a simple view of being present in nature and a visual diary of how I choose to spend my summer days – immersed, observing, and connecting. To purchase photography, please contact me at: Phone: 617-838-9686
Email: Reenie.murphy@comcast.net
@Reenie.Murphy
Marilyn Brodwick The photographs in this show explore themes of solitude, mystery, and the quiet poetry of place. An uninhabited ferris wheel is reflected in a newly created pool after a storm in Santa Monica. A lone man in a hat walks into the distance under a clouded sky. The path is unknown, the beach landscape, understated. A swing, strangely suspended in the toxic waters of Bombay Beach, part art installation and part a relic of playfulness becomes surreal and desolate. At First Encounter Beach, birds spiral in the sky with their mirrored images below in pools of water. Each scene is grounded in reality, yet tinged with ambiguity—inviting viewers to pause, wonder, and interpret. Marilyn began photographing as a teenager in Los Angeles drawn to finding interesting people on the street. Later in Galveston, Texas she taught photography for the Osher Lifelong Learning Institute (OLLI), ran a photography business, and worked as an epidemiology researcher at the University of Texas Medical Branch. Her role at UTMB eventually merged science and art when her photography became part of the institution’s outreach—resulting in two published books, Faces of Aging I and II. Marilyn’s work has been recognized with fellowships and awards including from the Houston Center for Photography and Rice University, and is in permanent museum collections such as the Museum of Fine Arts, Houston. She now divides her time between Cape Cod and Los Angeles, continuing to photograph wherever the light calls her and is known for constantly saying, “Just look at the light!”
Marbrodwick@gmail.com
@marilynbrodwick
SAME SPOT - DIFFERENT TIMES BY HANS RATH
SAME SPOT - DIFFERENT TIMES BY HANS RATH
(Land`s End from "Angel Foods")
Opening Reception: Friday, September 19 from 5 - 7 PM
On Exhibit through September 29
The Commons
46 Bradford Street, Provincetown
hansrath.com
I love to paint outside. To see the changing colors of the sky, the sea and the land is always exciting for me, especially here in Provincetown. When I start a painting at 2 pm and finish it at 4 or 5 pm, then the whole afternoon is in it. The process of painting is the real excitement. I follow the different formations of clouds and differnt colors of the sea, changing the painting until a situation satisfies me. Going back to the same spot and paint the same view to different times over and over is for me like meditation on life itself.
Workshop: Editing and Adjusting – An Introduction to Photoshop & Lightroom with Chris Perry
Workshop: Editing and Adjusting – An Introduction to Photoshop & Lightroom with Chris Perry
Workshop Details:
Date: Wednesday, September 24, 2025
Time: 5:00 PM – 6:30 PM
Location: The Commons
Click to Register:
Are you an artist looking to elevate the quality of your photos for social media, online stores, or promotional materials? This free introductory workshop will guide you through the basics of Photoshop and Lightroom, with a focus on color correction, white balance, and simple editing workflows to make your photos of artwork look crisp, true-to-life, and professional.
Designed for artists, makers, and creatives who regularly photograph their own work, this session will help you understand how to use Photoshop and Lightroom to both enhance and organize your images. You’ll explore the differences between the two programs and learn how to decide which tool best fits your practice—whether you’re adjusting photos for accuracy or experimenting with creative digital edits.
Free to attend – limited spots available!
Bring your laptop with Adobe Photoshop and Lightroom installed (free trial versions are fine).
No prior experience required.
Sample images will be provided, but you’re encouraged to bring digital photos of your own work to practice with.
This beginner-friendly session introduces artists, photographers, and creatives to the fundamentals of Adobe Photoshop and Lightroom—two of the most widely used tools for editing and managing images. Whether you are photographing your own artwork, adjusting colors for accurate documentation, or exploring creative ways to manipulate images, this workshop will provide the skills to expand your artistic possibilities.
Participants will learn the key differences between Photoshop (a full-featured editing and creation tool) and Lightroom (a powerful program for photo adjustment and organization). Through guided demonstrations and hands-on practice, you’ll explore basic workflows, including color correction, image adjustments, file organization, and exporting finished images.
By the end of the session, you’ll have a clear understanding of how to integrate Photoshop and Lightroom into your own creative process—whether that means fine-tuning photos of your work for a portfolio, experimenting with digital image manipulation, or developing a more streamlined editing workflow.
Details:
Duration: 1 hour 30 minutes
Audience: Beginner to Intermediate (no prior Photoshop or Lightroom experience required)
Format: In-person (option to offer live/online available)
Requirements: Laptop with Adobe Photoshop and Lightroom installed; sample images will be provided
About the Teacher:
Chris Perry currently resides in North Truro, Massachusetts and has an extensive background in fine arts, creative management, visual design and teaching with organizations such as IBM, Fidelity and University of Massachusetts, Lowell. As both a coach and mentor, Christopher enjoys cultivating environments where collaboration and individual talent flourish. A big reader who loves movies, music, cooking, woodworking and welding and a passion for history, he currently drives for Art’s Dune Tours in Provincetown.
MODERNO BY FRAN O'NEILL
MODERNO BY FRAN O’NEILL
Opening Reception: Friday, October 3 from 5 - 7 PM
On Exhibit through October 12
The Commons
46 Bradford Street, Provincetown
@Franionptown
Franoneillartist.com
My artistic vision focuses on the connection between healing and energy. We are all energetic beings, and the wood grain in my art symbolizes this universal energy. I incorporate dynamic shapes, composition, and color to represent this energetic exchange, which allows abstract forms to integrate seamlessly with the natural wood texture. My goal is to create an intersection where the energy in the artwork, the wood, and the viewer all converge. My work is modern and mid-century inspired with a kinetic feel that resonates with the viewer.
WORKS ON PAPER BY TIA SCALCIONE
WORKS ON PAPER BY TIA SCALCIONE
On Exhibit: through OCTOBER 12
Opening Reception: Friday, October 3 | 5:00–7:00 PM
There is nothing quite as satisfying as making marks on paper, whether with ink, paint, pen or pencil. This series is composed of my daily drawings, monotype prints and ink paintings.
@tiascalcioneart
LINES IN TIME: WHITE LINE WOODCUT GROUP SHOW
LINES IN TIME: WHITE LINE WOODCUT GROUP SHOW
Bill Evaul, Sherry Sherwood, Lorraine Kujawa, Darrell Smith, Kathryn Lee Smith, and Julie Gray
On Exhibit: through OCTOBER 12
Opening Reception: Friday, October 3 | 5:00–7:00 PM
Lines in Time: White Line Woodcut celebrates over a century of artistic innovation rooted in the unique white-line woodblock printing technique born in Provincetown, Massachusetts. Developed around 1915 by members of the Provincetown Printers—most notably B.J.O. Nordfeldt, Ada Gilmore, and Blanche Lazzell—this method revolutionized printmaking by using a single carved block with gouged lines separating hand-painted color areas, producing a luminous watercolor-like image bordered by the signature white lines. Influenced by Japanese ukiyo-e prints and European Modernism, the Provincetown Print distilled complex traditions into an accessible and distinctly American form, often capturing the Cape’s coastal life and spirit through bold shapes, flattened perspective, and intimate subject matter.
This group exhibition brings together contemporary artists to trace the lineage and evolution of the white-line print. From early masters like Lazzell and Maud Hunt Squire to present-day practitioners including Kathryn Lee Smith, the show highlights the enduring relevance and vitality of the technique. New works honor the tactile, meditative nature of white-line printing while pushing its boundaries through abstraction, expanded palettes, and narrative experimentation. Lines in Time invites viewers to explore how this Provincetown-born art form continues to evolve—bridging past and future, tradition and reinvention—with each carved line.
PARTICIPATING ARTISTS:
Darrell Smith: Darrell Smith learned white-line woodblock printing at the Provincetown Art Association Museum (PAAM). Kathryn Lee Smith (no relation) was his first teacher, and she learned the technique from her grandmother Ferol Sibley Warthen, who learned from Blanche Lazzell. He completed the Teaching Artist Development Program at PAAM in 2022. He regularly exhibits his work as a member of the American Color Print Society. Smith's work has been shown in juried exhibitions at PAAM, The Pontiac Creative Arts Center, and at Art Wellesley. In 2020, one of his prints was selected by the jury for the 50th annual Cherokee Trail of Tears Art Show held in Tahlequah, Oklahoma. In August 2022 he was featured in a show at Julie Heller Gallery East. His first solo show at Provincetown Commons was April 2023, with another solo show at the Wellesley Free Library in May 2024.
smithprovincetownprints.com
Julie Gray: Through my prints, I try to communicate the feeling of a place through the unique and historically rich medium of white-line woodcut printmaking. Whether it’s a specific landscape, building or a random cottage, my hope is that these prints allow the viewer to connect with their memories of Provincetown in some way. This method, originally created in Provincetown in 1914, allows me to break down a composition into tangible, discrete shapes and colors to develop the image. I am deeply indebted to Kathryn Lee Smith, granddaughter of Ferol Sibley Warthen, for her guidance in teaching me this traditional technique. The physicality of carving directly into the wood block resonates with me on several levels. Each cut and gouge from the wood contributes to the defining "white line" that frames and shapes the final image. This process is both deliberate and intuitive, a conversation between my vision and the inherent qualities of the wood itself. While I also work in oil painting and watercolor, I enjoy the direct, tactile nature of white-line prints. I strive to capture not just the visual elements of a scene, but its underlying mood and atmosphere. My prints are an attempt to create a sense of familiarity and connection for the viewer, inviting them to recall their own memories or experiences of the place.
Kathryn Smith: I have been making white line prints for my entire life, learning the method from my artist grandmother, Ferol Sibley Warthen, a student of Blanche Lazzell's, when I was four years old. Working in this tradition became my life's work. My prints draw heavily on the sense of a particular moment in time, whether that moment is conveyed as a representational image or an abstraction. The formal elements of the visual language give me the tools to transform the idea; the process of manipulating these elements to support the theme bring the idea into focus. The inherent warmth of the wood, the use of hand tools, the physicality of pulling the print, all are a significant part of the process which informs the final print.
@KLSprovincetownprints
kathrynleesmithwhitelineprints.com
Lorraine Kujawa: Reflections The multitude of life here in Provincetown feeds my work. My goal is to keep looking and reflecting on the interesting and the beautiful.
lkuj34@comcast.net
Sherry Sherwood: Focusing primarily on the white-line color woodcut (Provincetown Print) for the last forty years I have developed an advanced understanding of the medium and its history. By combining analytical cubism with the vibrant colors of Impressionism, I create an easily understood abstraction through light, energy, and motion. Drawing the viewer in through active and expressive compositions transporting them into a complex experience of a certain event. Within these lines and brush work, a sense of freedom emerges from a traditionally more restrictive woodblock printmaking process.
sherrysherwood.com
@Artist4Earth
THE LIGHT BETWEEN US | WOMEN'S GROUP SHOW
THE LIGHT BETWEEN
WOMEN’S GROUP SHOW
Opening Reception: Friday, October 17 from 5 - 7 PM
On Exhibit through October 26
The Commons
46 Bradford Street, Provincetown
Since November 2022, The Commons has been proud to host and foster conversation with our Women’s Group, a gathering of female-identifying artists on the Outer Cape. The group was formed to inspire creative endeavors, nurture community, and provide a space to share experiences and stories about sustaining an artistic practice. In a place where resources are often limited, knowledge, support, and connection become truly invaluable.
In tandem with this year’s Women’s Week (October 13–19), we are honored to present The Light Between, an exhibition that celebrates the power of expression, creativity, and voice. This show highlights the profound impact these women have on our creative community and invites you to experience their artistry firsthand.
SHADES OF GHEY BY JUSTINE CROSBY
SHADES OF GHEY BY JUSTINE CROSBY
Opening Reception: Friday, October 17 from 5 - 8 PM
On Exhibit through October 26
The Commons
46 Bradford Street, Provincetown
@shadesofghey
Art is the language that I use to contemplate the seen and the unseen. With a lifelong interest in both drawing & dance, I studied illustration in Savannah at SCAD, then received my BFA in Boston at MassArt. I have also performed on various stages in different capacities around the country. As a visual artist and a performance artist, I have connections in both fine art, illustration, dance, costume, makeup, and hair. I’ve worked in paper, paper mâché, fabric, copper wire, ink, gouache & acrylic, and mixed-media. And through these mediums, I’ve experimented in both 2-D and 3-D works, and in small to larger scale installations. My current obsession is lampshades. Specifically, bringing older lampshades a new life, in my favorite medium ~ paper. Handmade paper, vintage magazines, drawings, paintings, and sketches are all mixed together to form a one of a kind lampshade. Each shade tells a different story from every angle and the story continues to evolve depending on if the light is on or off. The possibilities feel endless.
METAL MANIA REDUX BY MARGOT STAGE
METAL MANIA REDUX BY MARGOT STAGE
Opening Reception: Friday, October 17 from 5 - 7 PM
On Exhibit through October 26
The Commons
46 Bradford Street, Provincetown
margotstage.com
My passion for “road metal” defies explanation. Rusty, mangled, flattened fragments of metal catch my eye and I can’t resist picking them up for my 20+ year collection. Many are old automobile parts -- the heat shield for a catalytic converter, the curve of a brake drum. Others are worn and re-shaped beyond recognition into lacy and scratched pieces — corroded and marked by time and weather. Not every bit of metal has come from the road. I found a lovely piece in a redwood forest in California; a bright blue piece of an old school locker in a scrap yard; a majestic scalloped circle fell off the bottom of a trash can beside a high school football field. This body of work has been created entirely without welding. I use wire, pop rivets, gravity and glue to assemble the pieces into sculptural forms. The material itself — the individual pieces — dictate the direction far more than my mind does. There are often delightful surprises, and sometimes crashing frustrations that need to be solved. I also use pieces of found metal to create series of mono prints. Metal Mania Redux raises several questions. Do we recognize beauty in deterioration and decay? Can we appreciate the marks that time and nature make on materials, as well as on ourselves? Will we bear witness to obsolescence and endless change?
WEIRD/WILD/WITHERING: COMPANION WORKSHOPS ON FLORAL DESIGN & SCULPTURAL INSTALLATION
WEIRD/WILD/WITHERING:
COMPANION WORKSHOPS ON FLORAL DESIGN & SCULPTURAL INSTALLATION
(register separately or together)
WORKSHOP I
WEIRD/WILD/WITHERING:
AUTUMNAL FLORAL DESIGN
Oct. 24, 2025 / 12:00 p.m. – 3:00 p.m.
Location: The Commons
$125 per person
Floral design and fine art involve similar principles and ideas. Drawing inspiration from the Dutch Masters, local artist and designer Jason Potter will guide workshop participants as they create their own wild, romantic floral arrangements. Participants will learn to balance texture with color, create movement with color and gesture, prioritize seasonality, develop unexpected color stories, and incorporate foraged botanicals. Participants will also learn to use environmentally friendlier mechanics and techniques. In celebration of Halloween week, participants will be challenged to incorporate a selection of weird, wild, and withering elements into their designs. Participants will receive individual guidance and feedback throughout. They will leave with their own arrangement and the skillset to create unexpected, painterly arrangements at home. Workshop fee includes instruction, tools, and materials, as well as beautiful blooms, foliage, and foraged botanicals.
Materials: Simple floral shears, such as FLOWER SCISSORS
WORKSHOP II
WEIRD/WILD/WITHERING:
SCULPTURE & INSTALLATION WITH FORAGED BOTANICALS
October 26, 2025 / 11:00 a.m. – 3:00 p.m.
Location: The Commons
$100 per person
Botanical installation is the nexus of art and floral design. Sculptural principles and techniques allow the floral artist to create fantastical environments such as arches and entryways, overhead clouds or canopies, and abstract suspended shapes. In the world of botanical installation, creativity—well, and gravity—reign supreme. Although some practitioners use toxic floral foam, the industry is moving to more sustainability conscious materials. In this workshop, participants
will learn and apply the principles of sculpture by collaborating on the design and execution of a large, foam-free installation to be exhibited outside the Commons. In an exciting twist, participants will learn foraging tips and techniques on an instructor-led foraging walk in the Shank Painter Road area. No heavy lifting is required; selected botanicals will be transported by truck. Participants and instructor will collaborate on sculpting a botanical installation outside the Commons’ front entrance. Learning to use botanicals in this way will allow participants to create installations at home (at holiday parties, for example) and add three-dimensional botanical sculpture to their artist toolbox. The forging walk is optional and will be customized to suit participant needs. In the event of inclement weather, foraged botanicals will be provided, and the installation will occur indoors. Workshop fee includes instruction, tools, and materials. Participants will spend much of the workshop outdoors and should dress accordingly. Plan to bring gardening gloves (or similarly protective gloves), such as GARDENING GLOVES
This workshop is part of our From the Earth series. Workshops will guide participants through exploring, recognizing, learning, and using the natural resources in abundance on Cape Cod. We'll focus on foraging, ink and paper making, and quiet observation of the fragile ecosystems that surround us. All workshops are artist-led with an emphasis on the human responsibility to protect and sustain our natural resources. From the Earth is supported by a grant from the Arts Foundation of Cape Cod.
Instructor Bio
Jason Potter is a Provincetown-based artist and floral designer. His avant-garde “Mycelium Bride” garment/sculpture appeared in the Commons’ 2025 Fashion Show and the accompanying group show. As a floral designer, Jason’s designs are inspired by textures of Cape Cod, the change of seasons along the coast, avant-garde fashion, and contemporary art. He owned and operated a floral studio in Provincetown from 2019 to 2021 and has designed for local and Boston-area retail and event floral designers, such as Heavy Petal, Botanique of Cape Cod, and Wilson Farms. Jason has extensive experience designing and executing botanical installations, such as floral “clouds” and “waves” for events. Today, his floral design practice is limited exclusively to designing and creating fantastical floral installations.
WEIRD/WILD/WITHERING: COMPANION WORKSHOPS ON FLORAL DESIGN & SCULPTURAL INSTALLATION (Copy)
WORKSHOP II
WEIRD/WILD/WITHERING:
SCULPTURE & INSTALLATION WITH FORAGED BOTANICALS
October 26, 2025 / 11:00 a.m. – 3:00 p.m.
Location: The Commons
$100 per person
Botanical installation is the nexus of art and floral design. Sculptural principles and techniques allow the floral artist to create fantastical environments such as arches and entryways, overhead clouds or canopies, and abstract suspended shapes. In the world of botanical installation, creativity—well, and gravity—reign supreme. Although some practitioners use toxic floral foam, the industry is moving to more sustainability conscious materials. In this workshop, participants
will learn and apply the principles of sculpture by collaborating on the design and execution of a large, foam-free installation to be exhibited outside the Commons. In an exciting twist, participants will learn foraging tips and techniques on an instructor-led foraging walk in the Shank Painter Road area. No heavy lifting is required; selected botanicals will be transported by truck. Participants and instructor will collaborate on sculpting a botanical installation outside the Commons’ front entrance. Learning to use botanicals in this way will allow participants to create installations at home (at holiday parties, for example) and add three-dimensional botanical sculpture to their artist toolbox. The forging walk is optional and will be customized to suit participant needs. In the event of inclement weather, foraged botanicals will be provided, and the installation will occur indoors. Workshop fee includes instruction, tools, and materials. Participants will spend much of the workshop outdoors and should dress accordingly. Plan to bring gardening gloves (or similarly protective gloves), such as GARDENING GLOVES
This workshop is part of our From the Earth series. Workshops will guide participants through exploring, recognizing, learning, and using the natural resources in abundance on Cape Cod. We'll focus on foraging, ink and paper making, and quiet observation of the fragile ecosystems that surround us. All workshops are artist-led with an emphasis on the human responsibility to protect and sustain our natural resources. From the Earth is supported by a grant from the Arts Foundation of Cape Cod.
WEIRD/WILD/WITHERING:
COMPANION WORKSHOPS ON FLORAL DESIGN & SCULPTURAL INSTALLATION
(register separately or together)
WORKSHOP I
WEIRD/WILD/WITHERING:
AUTUMNAL FLORAL DESIGN
Oct. 24, 2025 / 12:00 p.m. – 3:00 p.m.
Location: The Commons
$125 per person
Floral design and fine art involve similar principles and ideas. Drawing inspiration from the Dutch Masters, local artist and designer Jason Potter will guide workshop participants as they create their own wild, romantic floral arrangements. Participants will learn to balance texture with color, create movement with color and gesture, prioritize seasonality, develop unexpected color stories, and incorporate foraged botanicals. Participants will also learn to use environmentally friendlier mechanics and techniques. In celebration of Halloween week, participants will be challenged to incorporate a selection of weird, wild, and withering elements into their designs. Participants will receive individual guidance and feedback throughout. They will leave with their own arrangement and the skillset to create unexpected, painterly arrangements at home. Workshop fee includes instruction, tools, and materials, as well as beautiful blooms, foliage, and foraged botanicals.
Materials: Simple floral shears, such as FLOWER SCISSORS
Instructor Bio
Jason Potter is a Provincetown-based artist and floral designer. His avant-garde “Mycelium Bride” garment/sculpture appeared in the Commons’ 2025 Fashion Show and the accompanying group show. As a floral designer, Jason’s designs are inspired by textures of Cape Cod, the change of seasons along the coast, avant-garde fashion, and contemporary art. He owned and operated a floral studio in Provincetown from 2019 to 2021 and has designed for local and Boston-area retail and event floral designers, such as Heavy Petal, Botanique of Cape Cod, and Wilson Farms. Jason has extensive experience designing and executing botanical installations, such as floral “clouds” and “waves” for events. Today, his floral design practice is limited exclusively to designing and creating fantastical floral installations.
SPIRIT BIRDS BY ANTONY KIRMAN
SPIRIT BIRDS BY ANTONY KIRMAN
On Exhibit: through November 10
Opening Reception: Friday, October 31 | 5:00–7:00 PM
www.LOS.org
A photographer most of my life, I have been color-grading and printing my own work seriously for 10 years. I started painting my spirit birds when I first came to the Cape in 2017, and then took an oil painting class by Sky Power in 2022 and try to paint or draw every day. I have also taken a woodblock printing class Vicki Tomayko and a feminist collage workshop by Megan Hinton. I have had photography shows at SohoPhoto gallery in NYC, and been in various group shows at PAAM. I have sold my work from the Artist Cottages at Orleans Market Square, for the last 7 years.
PADRIC AND MICHAEL: THE FIRST 50 YEARS
PADRIC AND MICHAEL: THE FIRST 50 YEARS
Works by Padric Meagher and Michael Guy
On Exhibit: through November 10
Opening Reception: Friday, October 31 | 5:00–7:00 PM
PADRIC MEAGHER: Why read this instead of perusing the “art”? Call with questions —
401-573-5379. Thanks.
pmmrealestate@gmail.com
MICHAEL GUY: Just for fun, in 1979, I asked a friend to take a snapshot of me at the beach wearing a red bikini and a paper cutout of Santa Claus’ face as a mask. I made a few prints for friends as Christmas cards, never imagining that for 45 years I would be wracking my brain every year to come up with a new goofy idea for celebrating the holidays. Other than the fourth card in 1982 or the Smackdown audience in 2016, I’m the only person — or all the people — in the photos, which have been taken by friends, my husband Padric, or often by myself. Frequent collaborators are my friends Frosty and Rudolph. Though Photoshop has proven useful in recent years for a little assistance — and it’s pretty obvious when I’ve used it — I was really there at those locations in those costumes with those props. Happy holidays!
trinityartguy@gmail.com
LIFE IN TECHNICOLOR BY BRAD MITCHELL
LIFE IN TECHNICOLOR
Works by Brad Mitchell
On Exhibit: through November 10
Opening Reception: Friday, October 31 | 5:00–7:00 PM
bradmitchell202@gmail.com
@leggo__the__ego
I am an Outer Cape artist who, like many, came to Cape Cod for a respite from city life…and never left. I uprooted a longtime existence in Washington, DC for the Outer Cape and its surreal landscape, expansive shorelines, and magical sky.
My work is focused on translating onto canvas the energy, love, and magic I feel as I walk in the woods, the dunes, and along the bay and ocean shorelines, all while being mesmerized by the Cape’s big, beautiful, ever-changing sky.
If I had to sum up my work in three words, they would be: Life in technicolor.
PIE FEST - SALTine + SWEET
🍰 THE COMMONS PIE FEST
Sunday, November 9 | 1–3 PM
The Commons, Provincetown
Join us for an afternoon filled with music, friends, and of course, PIE! Hosted by Kristen Becker, Pie Fest brings together local favorites and visiting bakers for a lively competition, pie auction, and plenty of slices to share.
This year’s festivities include:
Live music from DJ Potato Salad and Zoe Lewis
Coffee by JOE Coffee and seasonal hot toddys
Judging panel featuring past winners and James Beard Award–winning chef Kelly Fields
Pies from Angel Foods, Salty Market, Pop & Dutch, and beloved local bakers
Every baker will create two pies—one for judging and one for the auction—so you can bid on award-winning creations to take home.
And don’t miss this year’s exclusive Pie Fest swag:
“Our Own Little Slice of Heaven” tumblers
Angel Slice logo baseball caps
Whether you come to cheer on bakers, swap recipes, or just enjoy a sweet afternoon with friends, Pie Fest guarantees a good time—and plenty of pie.
This event is complimentary. The Commons is a nonprofit organization and relies on charitable donations—your support helps keep the tradition alive.
FLORA + FAUNA OF BEECH FOREST | JIMMY LEE'S FASHION SHOW
You’re Invited to Jimmy Lee’s Annual Fashion Show
FLORA + FAUNA: BEECH FOREST
A journey into the wild, the wondrous, and the unknown.
Step into the heart of Beech Forest—a place where myth and nature blur, where shadows dance with light, and creativity runs untamed.
Saturday, August 23 | Provincetown, MA
Cocktails in the front yard begin at 6 PM
The show unfolds at 7 PM
This year, over 20 visionary artists come together to present an evening of avant-garde, transformative fashion inspired by the enchanted landscapes of Cape Cod’s Beech Forest. Expect bold expression, wild silhouettes, and a celebration of nature’s mysterious beauty.
Over 30 of our favorite models will walk the forest runway this year, bringing each look to life with power, grace, and theatrical flair. Models will be announced at a later date.
All featured looks will be available for bidding and highlighted in a printed lookbook released ahead of the show. Proceeds from sales will be split between the artists and The Benji Fund—a local initiative that supports Cape-based creatives by helping cover studio rent, exhibition costs, art materials, and other essential needs that make a sustainable art practice possible.
Let’s celebrate what makes Provincetown so extraordinary—its creativity, its generosity, and its unyielding spirit.
Thank you for being part of this magical night. We wouldn’t want to do it without you.
Let yourself get lost.
Follow Jimmy Lee into the forest.
IN SIGHT BY JENNIFER PINCK
IN SIGHT BY JENNIFER PINCK
Opening Reception: Friday, August 22 from 5 - 7 PM
On Exhibit through September 1
The Commons
46 Bradford Street, Provincetown
@jenpinck
www.jenpinck.com
As a painter I am fascinated by images that capture a place and a time, and that can feel familiar to anyone. Color, shadow, and geometry are the elements that I explore and seek to share.
Working now in my Gloucester studio, on the other Cape, I return regularly to the memories and scenes I collected over 30 plus years in Provincetown - under the influence of the incredible light and the myriad artists who have been or are still smitten by the place.
FLORA + FAUNA ENCHANTED FOREST
FLORA + FAUNA ENCHANTED FOREST
Group show with works by Amadeo Gjrra, Luanne Witkowski, Gin Stone, Justine Crosby, and Andrey Quintana
Opening Reception: Friday, August 22 from 5 - 7 PM
On Exhibit through August 31
The Commons
46 Bradford Street, Provincetown
In tandem with this year’s fashion show, Enchanted Forest is a group art exhibition that invites visitors deeper into the myth and mystery of Cape Cod’s Beech Forest. Installed in the heart of The Commons, the Community Room will be fully transformed into an immersive woodland environment—lush with organic textures, dappled light, and sculptural elements that echo the forest’s quiet magic. This enchanted space becomes both gallery and dreamscape, setting the stage for works in painting, sculpture, installation, and mixed media that reflect themes of metamorphosis, shadow, and nature’s resilience.
Each piece in the exhibition speaks to the fantastical energy of the fashion show, extending its narrative into a more contemplative realm. As with the runway, this show supports The Benji Fund—helping to sustain the creative lives of Cape-based artists. Enchanted Forest invites you to wander, to lose yourself, and to rediscover the power of art rooted in place, imagination, and community.
Untitled (light/dark), 2024
Acrylic on canvas
46 x 46 in
Andrey Quintana
QUINTANA USES A BULLET AS HIS BRUSH.
Andrey Quintana paints with intention of creating splendor and beauty in search of liberation from dark times. He uses an actual bullet— an object typically used to inflict pain— as his brush, in a magical transformative process. Quintana's paintings are large canvases of vibrantly colored flowers. His technique creates thick, lustrous, textured fields. The artist conveys the need for change while provoking the viewer to remember and rejoice in nature's beauty.
Amadeo Gjurra
Queerly Poletastic
Nightlife Fauna of Provincetown
Dive into Provincetown’s queer nightlife, where pole performers spin and soar under blacklight, turning movement into a vibrant act of erotic self-expression, queer power, and unapologetic artistry.
Queerly Poletastic is a video installation that reimagines Provincetown’s queer nightlife, transforming pole dancing into a powerful story of queer expression through an immersive gallery experience. It immerses viewers in the town’s vibrant queer ecosystem, where sculptural, meditative presentations meet energetic, immersive documentaries—revealing the many ways queer performance can move, inspire, and delight. In the sculptural work, static frames of dancers spin on a vertical monitor, with RGB lighting amplifying every silhouette and motion. Holographic fabrics scatter light across the gallery, reflecting the rainbow vibrancy of queer expression. UV lighting evokes the energy of nightlife, while UV-painted dollar bills highlight the often overlooked value of the performers’ artistry.
The immersive documentaries pull viewers into the choreography itself. Moving in real time with the dancers, the camera lets you feel the rhythm, momentum, and joy firsthand—like riding a “pole rollercoaster” alongside the performers. The line between audience and artist dissolves, inviting empathy, insight, and shared celebration.
Through these contrasts, the work celebrates resilience, creativity, and queer joy, reframing pole dancing as both a personal and cultural practice. It’s a journey through Provincetown’s living landscape, where nocturnal nightlife and daylight wonder coexist like fauna and flora in a magical enchanted forest.
Amadeo Gjurra is a queer immigrant filmmaker from Albania, who documents the vibrant nightlife of Provincetown, MA, where he currently lives. With a background in UX/UI design and theatrical/vocal performance, his work combines documentary film, entertainment, and activism. Amadeo’s interdisciplinary practice amplifies queer voices across media platforms, using films as catalysts for change. Recent projects focus on increasing the visibility of queer identities within the pole dancing industry and communities, aligning with his commitment to inclusivity and empowerment.
GIN STONE
I will inhale smoke and exhale butterflies
As an interdisciplinary artist, I work in fiber, painting, pen and ink, hand and machine sewing and mixed media constructions/installations that bear the weight of environmental activism and animal advocacy. I have also used photography to document the work of environmentalists. My current interest is focused on the concepts of the bardo experience occurring in the animal world, what animism means and what that means to the humans that cause death either directly or indirectly.
a remembrance
2019
cyanotype printed cotton duck, reclaimed nails, shed antlers and mixed media
80 x 10 x 14 in.
Head printed with frontal cyanotype of deer skull, sides printed with two jaw mandibles, body print of wildflowers and grasses. Nails from my late father’s workshop. Depicting the balance of life, death and what is left.
My materials have included salvaged ghost gear (a hazardous form of marine debris that endangers the oceanic environment from the surface tension at the top of tumultuous waves to the darkest pressures on the sea floor), recycled and antique textiles and furs (both being grotesque and beautiful in their own ways), and found/collected/border-line-hoarded objects.
By appreciating the fleeting beauty of what is, it imparts one with the angst and ennui of a knowledge of its faulty adaptability in a roiling sea of manmade change.
unnatural decay/ denim split gill mushroom
2024
recycled denim, dye, canvas, recycled fabric, waxed cotton thread, adhesive, ghost gear net
60 x 72 x 1 in.
meditation on climate grief. how do things decay when the material is not natural.
we will become the fodder for what comes next.
We’re outta here (Tiger Bardo)
2025
84”H x 108”W
acrylic on raw canvas, charcoal, conte crayon, sewn canvas and linen, thread, india ink
Luanne E Witkowski
Studio Visit with Luanne E Witkowski
Clarity
The daily routines of walking through forests, parks, and countryside of wildlife, flora and fauna followed by engagement with city streets, glass and artificial light interweave and inform as Witkowski creates and explores the interaction and juxtaposition of various materials. In doing so, she recalls the shared experiences grounded in each of us-- creating a perceptual and spiritual relationship for recognition of and solace for the self. This approach to the identification of the individual with landscape and environment is enlarged by a desire to discover and contact the particular indwelling essence or energy of clarity.
Aureolin, 33.5”x 17” mixed natural and fabricated materials, 2022
Royal, 18.5”x 12” mixed natural and fabricated materials, 2022
This body of work is a response to the world around and within us. The relationships are interwoven. Nature’s handiwork impresses and informs all matter –present and passed, permanent and ephemeral, physical and virtual. Layers of materials and recollection create perceptual and spiritual relationships that serve as a locus for grounding, recognition, and solace. In her March 2023 solo exhibit, Clarity, Witkowski reflects on shared isolation, the impacts of repetitious exposure, and salvation. She uses both found natural materials and fabricated cast-offs and scraps, focusing on composition, recurrent pattern, minimalist form, and color to create a response to the fragile systems of beauty and the power that exist in both the natural world and urban landscapes. All of this is accessible through the contemplative creative process of perception and felt by us when we allow ourselves to relax and use our five senses.
Peace Offering VIII, mixed fabricated and foraged materials on canvas, approx. 13” x 12”, 2025
Verdant, 36.5”x 30” mixed natural and fabricated materials, 2022
Passage, 32”x 9” mixed natural and fabricated materials, 2023
Justine Crosby
Art is the language that I use to contemplate the seen and the unseen.
With a lifelong interest in both drawing & dance, I studied illustration in Savannah at SCAD, then received my BFA in Boston at MassArt. I have also performed on various stages in different capacities around the country. As a visual artist and a performance artist, I have connections in both fine art, illustration, dance, costume, makeup, and hair. I’ve worked in paper, paper mâché, fabric, copper wire, ink, gouache, acrylic, and mixed-media. And through these mediums, I’ve experimented in both 2-D and 3-D works, and in small to larger scale installations.
My current obsession is lampshades. Specifically, bringing older lampshades a new life, in my favorite medium ~ paper. Handmade paper, vintage magazines, drawings, paintings, and sketches are all mixed together to form a one of a kind lampshade. Each shade tells a different story from every angle and the story continues to evolve depending on if the light is on or off. The possibilities feel endless.
@shadesofghey
ECHOES OF THE PROVINCE LANDS BY PAUL CUNNINGHAM
ECHOES OF THE PROVINCE LANDS BY PAUL CUNNINGHAM
Opening Reception: Friday, August 22 from 5 - 7 PM
On Exhibit through September 1
The Commons
46 Bradford Street, Provincetown
@Paul-Cunningham-39
paulcunninghamart.com
I began working on three-dimensional art in a metal sculpture class, becoming enamored with the shapes I could conjure up using wire mesh. I relied initially on a serendipitous construction process, creating random forms and experimenting with new materials, surfaces and color. The Covid years impacted my practice in two significant ways: the free form construction of earlier work gave way to very structured rhythmic curves, while playful color choices were replaced by a palette inspired by “place” - primarily the colors of Provincetown and the marshes where we spent a good part of our time before moving here permanently two years ago.
My dog Bond and I walk the stretch of Province Lands Road from the breakwater to Herring Cove Beach at any given time of the day, at any given time of the year. As tides change and one season’s palette gives way to another, it is a landscape that can be lush and green, or cold and desolate, but always beautiful and calming. I try to capture the rhythm of that change and the echos of that landscape in the new work presented in this exhibition.
NATURAL COLOR + INK MAKING
Natural Color + Ink Making
with Grace Emmet and Milisa Moses
Date: Saturday August 16, 11 - 2 PM
Where:
The Commons
46 Bradford Street, Provincetown
Cost: $25
Register Below:
(space is limited)
This workshop will explore plants and the colors that can be created from them. Work with artists and naturalists, Grace Emmet and Milisa Moses, to make inks for painting and printmaking from charcoal, berries, flowers and more. Learn basic recipes to render color for your art practice, creating a truly unique palette.
Bios:
As a process based, interdisciplinary artist and gardener, Milisa Moses combines printmaking, plant growing and (plant) alchemy to document time, space, and light. Her work is facilitated by celestial cues, Fibonacci sequence, the dawn chorus: nature’s vernacular spoken through light and dark, pattern and sound. Currently the Curator of Museum Education at the Provincetown Art Association and Museum, Milisa has taught workshops across Cape Cod, including at The Museum School at the Provincetown Art Association, Castle Hill in Truro, and out of her former shop/studio space, Plant Work Shop in Orleans.
Grace Emmet is an eco-artist, educator, writer, and naturalist. Her place-based art practice is dependent on an intimate relationship with the land informed by her foraging and natural ink making process. Her work has been shown in galleries, museums, and universities across the Northeast. Grace has taught workshops at the Provincetown Art Association and Museum, Cultural Center of Cape Cod, and the Arlington Center for the Arts.
Websites: https://www.milisamoses.com, https://www.graceemmet.com
Instagrams: @milisa_moses and @graceemmet_illustration
FOLLOW THE LINE BY R. S. STEINBERG
FOLLOW THE LINE
Works by R.S Steinberg
On Exhibit: through August 18
Opening Reception: Friday, August 8
| 5:00–7:00 PM
R. S. Steinberg ARTIST BIO
Paternal punishment for drawing on the walls of his childhood NYC apartment did not deter R. S. Steinberg from doodling in the margins of college and medical school notebooks. After practicing orthopaedic surgery near Boston he earned an MFA in creative writing; now in his dotage he is free to follow the line through imagination to images realized on paper.
IDOLS BY AMY FORD
IDOLS
Works by Amy Ford
On Exhibit: through August 18
Opening Reception: Friday, August 8 | 5:00–7:00 PM
We are creatures of devotion. From saints to celebrities, gods to influencers, trophies to totems—humans have always created and clung to idols. IDOLS explores this instinct: our deep need to lift something above ourselves, to fix our gaze on a figure, a symbol, a body, a dream. Whether sacred or profane, physical or imagined, idols give shape to our longings.
This body of figurative work draws from religious iconography, pop culture, and personal mythology to question what we worship and why. Some idols guide us. Others deceive. They can inspire greatness or demand submission. They may reflect our highest aspirations—or expose our deepest insecurities. In their presence, we project, adore, envy, emulate. We kneel or revolt.
These figures are not passive—they look back. They ask: who gave me this power? What do you see in me? What are you really worshipping?
IDOLS does not offer judgment, only a mirror. It invites the viewer to consider the beautiful, the troubling, and the inevitable ways we shape our identities through what—and whom—we exalt. Because whether we're seeking meaning, validation, or transcendence, we rarely do it alone. We build idols to find ourselves.
WORN, WEATHERED, WOVEN BY JANET BEATTIE
WORN, WEATHERED, WOVEN BY JANET BEATTIE
Opening Reception: Friday, August 8 from 5 - 7 PM
On Exhibit through August 18
The Commons
46 Bradford Street, Provincetown
@jbeatt50
www.janetbeattie.com
My current work centers on the assemblage and collage of repurposed metal, Provincetown driftwood, and a variety of found objects gathered during my walks and wanderings. I weave together these materials—each with its own history—through an intuitive process that balances color, texture, and pattern. Guided by shape, size, and a sense of play, I allow the composition to unfold organically, letting the materials themselves influence the direction of each piece.
I also make vessels out of layered paper and wood, combining simple materials to build textured forms. Each piece comes together through wrapping, layering, and sometimes tearing back again. I let the process guide me, again choosing shapes and colors based on feel and balance rather than a fixed plan. My hope is that each one feels grounded, honest, and open to interpretation, like small meditations in physical form.
I hold a degree in Applied Art from Iowa State University, with a focus in fiber and design, which continues to inform my approach to layering and surface. My studio at Whaler’s Wharf in Provincetown is open by appointment, where I welcome conversations about the work and am happy to discuss personalized commissions. Each piece is a meditation on place, transformation, and the beauty found in the unexpected.
ELENI CARR
FOR THE LOVE OF TREES
Works by Eleni Carr
On Exhibit: through August 4
Opening Reception: Friday, July 25 | 5:00–7:00 PM
eacarr7@msn.com
I've had a penchant for photography ever since I can remember, requesting my first camera on my 7th birthday. My parents rewarded me with a state-of-the-art Polaroid, which was simply the coolest thing! We could witness photos come to life from virtually nothing! My work has been through many iterations, including the pursuit of sharp, crisp imagery that is the mainstream standard. These days, however, I am far more interested in capturing emotion, mood and a sense of mystery as if to question, 'What do I see? How did this shot come to be?' Using various techniques like intentional camera movement (ICM) and multiple exposures, coupled with digital tools, I invite viewers to question the images I create and to explore the feelings they evoke. In this show, I am sharing mostly alternative type imagery with a few traditional shots mixed in as accents. The subject of trees came about on the many solo walks I take here on the outer Cape, mostly during the more desolate winter months when the trees' bare bones reveal their naked essence. While many of the tree images hail from the Cape, there are several from upstate NY and some from more temperate climates including Los Angeles, Florida's Gulf coast and San Pancho, Mexico. I hope you enjoy the show and take away the ethereal sense that trees inspire.
PTOWN PALETTE BY KATHY COTTER
PTOWN PALETTE BY KATHY COTTER
Opening Reception: Friday, July 25 from 5 - 7 PM
On Exhibit through August 4
The Commons
46 Bradford Street, Provincetown
For me this show will include a variety of works depicting people , places, and more that evoke an emotional connection or memory through the use of color to create sentiment or mood whether it's joyful , melancholy, or nostalgic. I look forward to sharing these works with you.
@provincetownart
www.kcotter.com
SUSAN PIERCE
SUSAN PIERCE
Opening Reception: Friday, July 25 from 5 - 7 PM
On Exhibit through August 4
The Commons
46 Bradford Street, Provincetown
Susan is inspired by light and sky; she captures the beauty of a scene through its interplay with its surroundings. She lives in the Boston area and, in summers on Cape Cod, she enjoys painting plein air and participating in workshops with other artists. Susan is a physician, retired from a career caring for cancer patients. Now, after decades of focus on science and medicine, she is engaged in the creative process of applying paint to panel. Primarily a impressionist landscape painter, she also enjoys painting lighthearted whimsical pieces to lift the spirit.
susanpierceart.com
BUILD A CLAY BEAR BY TRURO CLAY WORKS
Ages
Adults
Dates
Wed, Jul 16, 2025 - Jul 16, 2025
Time
5:00pm - 7:00pm EDT
Location
46 Bradford St, Provincetown, MA 02657
Instructors
Amy K., Emily S.
Capacity
15 students
Class Experience
In honor of Bear Week and Amy Kandall's exhibition at the Commons entitled Barely Domestic we will be gathering at the Commons to wlecome bears and bear lovers to unite for this fun two hour sculpting session, exploring the animal and all its feral components.
PAPER MAKING WITH ORGANIC MATERIALS
Paper Making with Organic Materials
with Sheryl Jaffe
Date: Saturday July 12, 1 - 4 PM
Where:
The Commons
46 Bradford Street, Provincetown
Cost: $25
Register Below:
(space is limited)
The joy of working with fibers is how versatile they are and how well they connect with each other. In this "no experience necessary" papermaking class you will learn all the steps in making paper from plants and their tenacious, strong, flexible, cellulose fibers. We will use phragmites, seaweed, kozo (mulberry), banana leaf, flax, queen Anne's lace, and other locally foraged, grown and invasive plants. If you like, bring some plant materials (preferably cooked or dried), yarn, thread, cloth and an open mind for an afternoon of experimentation and fun. You will leave with several (a dozen or so) unique handmade papers to enjoy as is or to include in your own artmaking practice.
Bio: Sheryl Jaffe has been exhibiting her artwork throughout New York and New England for over thirty years. She works with organic materials, handmade paper from local and exotic plant fibers, and found objects to create two and three-dimensional works that are reminiscent of the human body and the strength and frailty of skin. Her work includes installations, sculpture, pulp painting, artist books, and prints. These works are evocative offerings for viewers to move through, make discoveries, and be drawn into contemplation. She studied traditional hand papermaking in Japan and China and has taught papermaking at home and abroad. Jaffe was a resident artist at The Barn, Edward Albee Foundation and at Yellowstone National Park. She teaches art, ceramics, printmaking, book arts and papermaking at museums, public schools and art centers. When not in her studio, you can find her swimming in the bay or walking in the woods. "I am endlessly fascinated by how fibers connect and reconnect, intertwining in new ways, transforming the old into something new."
o Website: sheryljaffe.com
o Instagram:@sherylannjaffe
ALMANAC - A YEAR AT THE SEA IN 365 VARIATIONS BY KATE MCCONNELL
ALMANAC - A YEAR AT THE SEA IN 365 VARIATIONS BY KATE MCCONNELL
Opening Reception: Friday, July 11 from 5 - 7 PM
On Exhibit through August 4
The Commons
46 Bradford Street, Provincetown
@katemcconnellart
kate-mcconnell.com
These sea observations were painted plein air from the exact same spot along the waters’ edge of Cape Cod Bay in Provincetown, MA no matter the conditions.
My intention was to quickly capture the ever-changing energy of the sea, sky, and tides creating a sensory moment in time, marked by sunlight shifts and tidal patterns.
I began this series in 2017 as a warmup to my painting practice, which evolved into assembling a visual ‘almanac ‘with a target of 365 ‘studies.’ I completed the challenge in 2023 with 375 + journal entries.
Each piece includes a ledger of the weather, date + time, temperature, and other conditions, (and occasional current event) written on the reverse side.
Painted in oil, each piece is on 300# Fabriano cold-pressed paper, hand torn to retain the deckled edge, and prepped with 3 coats of gesso.
With each study, I compiled an almanac of the sea and me.
BARELY DOMESTIC BY AMY KANDALL
BARELY DOMESTIC BY AMY KANDALL
Opening Reception: Friday, July 11 from 5 - 7 PM
On Exhibit through July 21
The Commons
46 Bradford Street, Provincetown
The mixed media exhibition by Amy Kandall’s entitled Barely Domestic will be on display at the Commons in Provincetown from July 9th through July 21st
The subject matter of the exhibition explores an alter ego of a feral bear and a domestic girl who support each other through trials and tribulations of transformation. It is a story that takes place inside a domestic environment. Flipping ideas of what is inside and outside, what is real and what is theater, what is seen, felt and imagined. It is a story about spending real time with a spirit animal. The two dance, read books, play pretend and take turns emoting.
The exhibition contains small to large scale ceramics sculpture, a series of mixed media ceramic wall dioramas and large scale oil paintings honoring the heroic bear. Amy Kandall is the founder of Truro Clay Works; a community ceramic studio open for classes. She has her BFA from SUNY Purchase and her MFA from Bard College. She has been an art educator in our local school system for over 25 years.
SNAPSHOTS BY SETH STEVENS
SNAPSHOTS BY SETH STEVENS
Opening Reception: Friday, July 11 from 5 - 7 PM
On Exhibit through July 21
The Commons
46 Bradford Street, Provincetown
@sethstevensart2
I have been an artist working in Provincetown and Connecticut for the last 8 years. I work primarily in oil and gouache, but have also been experimenting with collage recently. I love the landscape and streetscapes in Provincetown and these are frequent subjects in my paintings, as are the rural landscape of New England. I am often not a careful painter and I value that spontaneity and the energy it gives a piece of work. I try to capture quick snapshots or stories in my paintings and to make a simple, strong impression.
RITUAL & REFLECTION: CRAFTING FOR THE FOREST RUNWAY
RITUAL & REFLECTION: CRAFTING FOR THE FOREST RUNWAY
Hosted by Mike Sullivan
Date: Tuesday, July 8 | 4:00–7:00 PM
WEBSITE
INSTAGRAM
Join artist and musician Mike Sullivan for a hands-on maker’s workshop focused on creating masks, headpieces, and accessories for this year’s Flora + Fauna of Beech Forest fashion show.
The session will begin with a live demonstration on mask-making and mold techniques, followed by time and space for participants to begin crafting their own pieces. Whether you're envisioning a dramatic headpiece, an abstract mask, or intricate accessories, this is a chance to develop work that complements your look for the show.
We’ll provide a wide range of materials—from natural elements to decorative and found objects—and welcome your creativity, experimentation, and bold ideas. Mike will be on hand throughout the session to guide, inspire, and support your creative process.
We’re also planning a follow-up workshop closer to the show in August, where participants can return to continue building their creations—especially those incorporating birds and more elaborate designs.
“Masks are a means by which human groupings attempt to communicate their dignity and sense of purpose.”
– Gary Edson, Masks and Masking
About the Artist:
Mike Sullivan is an artist and musician whose work spans sculptural headwear, portrait photography, and collaborative performance. Known for pieces that combine natural elements like feathers and branches with jewels, mirrors, and found objects, Mike’s work lives in the tension between decadence and decay, balance and chaos. He has been deeply immersed in queer creative communities in both Provincetown and New York City, producing concerts and multimedia fundraisers rooted in theatricality and expression.
REGISTER BELOW: SPOTS ARE LIMITED
SOURCED VESSEL ART THERAPY WORKSHOP | NURTURE - VESSEL IN CLAY
Sourced Vessel: Art Therapy Workshop
The Commons 2025
Free to attend, $20 suggested donation at the door.
Duration: 90 minutes
Register Below:
This Art Therapy workshop was designed for women, especially mothers. Held in a nurturing environment as a non-judgmental space, where emotions are welcomed and honored. Over four sessions, we navigate the lunar phases like a sacred map. Through breathwork, intuitive movement, presence, and artistic engagement, we open a portal to genuine self-expression. Shared rituals and personal reflections support women in return to themselves, reclaiming their identity, creating time for themselves, holding agency from themselves, and building connections with others who might be on a similar path.
No artistic or astrological experience is needed, just a willingness to engage and feel
● #01 Full Moon – On the Surface | Soul Collage®
● #02 Waning Moon – A Dive into the Unconscious | Watercolor Flow
● #03 New Moon – Treasure Rising | Melted Wax Mandala
● #04 Waxing Moon – Nurture | Vessel in Clay
SOURCED VESSEL ART THERAPY WORKSHOP | TREASURE RISING - MELTED WAX MANDALA
Sourced Vessel: Art Therapy Workshop
The Commons 2025
Free to attend, $20 suggested donation at the door.
Duration: 90 minutes
Register Below:
This Art Therapy workshop was designed for women, especially mothers. Held in a nurturing environment as a non-judgmental space, where emotions are welcomed and honored. Over four sessions, we navigate the lunar phases like a sacred map. Through breathwork, intuitive movement, presence, and artistic engagement, we open a portal to genuine self-expression. Shared rituals and personal reflections support women in return to themselves, reclaiming their identity, creating time for themselves, holding agency from themselves, and building connections with others who might be on a similar path.
No artistic or astrological experience is needed, just a willingness to engage and feel
● #01 Full Moon – On the Surface | Soul Collage®
● #02 Waning Moon – A Dive into the Unconscious | Watercolor Flow
● #03 New Moon – Treasure Rising | Melted Wax Mandala
● #04 Waxing Moon – Nurture | Vessel in Clay
A FAMINE OF BEAUTY BY MATTHEW HINES
A FAMINE OF BEAUTY
by Matthew Hines
Opening Reception: Friday, June 27 from 5 - 7 PM
On Exhibit through July 7
The Commons
46 Bradford Street, Provincetown
Artist Statement
After 25 years in San Francisco, I recently relocated to Provincetown—a place with a rich history of artistic expression and a strong sense of creative community. For many years, I lived and worked as an artist in California, where my practice was a central part of my identity and daily life. That path was interrupted by a medical condition related to my HIV diagnosis, which forced me to step away from creating.
Returning to art has not been without hesitation. There is vulnerability in putting my work back into the public eye after so much time. But there is also a quiet urgency—a need to reconnect with my creative self, to explore what has shifted in my voice, and to heal through the act of making.
This exhibition marks a reawakening. It is both a return and a beginning. Through this work, I hope to connect with others—especially the artists of Provincetown—and to once again be part of a dialogue that has always given me purpose.
THE SUMMER OF ‘24 - FIGURES AND PLACES BY NEIL KORPINEN
The Summer of ’24 - Figures and Places
by Neil Korpinen
Opening Reception: Friday, June 27 from 5 - 7 PM
On Exhibit through July 7
The Commons
46 Bradford Street, Provincetown
At the end of last summer I began a group of paintings that seemed tinged with nostalgia. In this current era of chaos and disbelief the theme has taken on an additional meaning. Though the setting is at the beach the subdued palette lends a tonal, atmospheric quality to the landscape. Lone figures are mostly looking away, remembering the good carefree times of the past summer and perhaps years gone by. The Summer of ’42 movie is a good coming of age story but The Summer of ’24 is about looking back.
End of Season, o/c, 40” x 30”
A second group of paintings includes portraits of friends in a studio setting, each done over the course of several sittings. The models, though sometimes nude, are not objects of fantasy or desire, just real people posing in a real studio, projecting friendship even while enduring the boredom that often comes with modeling. Thank you my friends!
BFF, o/c, 36” x 36”
The third group of paintings continues the theme of Figure in Place, though now the setting is a swimming pool. Whenever a picture shows a pool with swimmer the mind naturally goes right to a certain celebrated artist so these paintings can be considered an homage to David Hockney. When my friend Michael Childers, who is in turn friends with Hockney, saw my paintings he insisted on taking my portrait for this show, recreating the poolside scene with the models. Thank you Michael for the fabulous photograph!
Michael Childers photograph
Neil Korpinen has enjoyed a long career as an artist and interior designer. A RISD grad, he hails from nearby South Carver where his family has grown cranberries for 100 years (and he claims to have been coming to Provincetown for about that long). Neil has studied painting and drawing locally at FAWC, PAAM, The Hawthorne Barn and Castle Hill.
Eight years ago Neil and husband Rick Erickson restored an antique home in Provincetown. They split their time between here and Palm Springs.
BATHING BEAUTIES, BEAUTY PRODUCTS, & CARNIES BY CELESTE HANLON
BATHING BEAUTIES, BEAUTY PRODUCTS, & CARNIES BY CELESTE HANLON
Opening Reception: Friday, June 27 from 5 - 7 PM
On Exhibit through July 7
The Commons
46 Bradford Street, Provincetown
@celestehanlonart
celestehanlon.com
I grew up in the 1970’s in Greenwich Village, NYC. My father was a writer & my mother owned a vintage clothing store called “O Mistress Mine”. The clothing and the customers left an impression on me and ultimately inspired my art aesthetic . I have come to love everything vintage, from the fashion, make-up, and designs of everyday objects and products.
The focus of my work largely depicts images of women and beauty products of brands from the past in various mediums. I’ve been revisiting drawings I made and scaling them down into paintings and collages. My work is graphic in style using pen and ink with bright colored backgrounds or stretched vintage patterned fabric.
My ongoing series of Bathing Beauties reflects nostalgic memories of family, friends and experiences of yesteryear. My series "Carnies” draws its inspiration from the physical abilities and bravery of carnival performers living their lives as “outsiders” while traveling from town to town, on the fringe of a “normal” society.
My influences include Diane Arbus, Ben Shaun, Lisette Model and Andy Warhol.
SOURCED VESSEL ART THERAPY WORKSHOP | A DIVE INTO THE UNCONSCIOUS - WATERCOLOR FLOW
Sourced Vessel: Art Therapy Workshop
The Commons 2025
Free to attend, $20 suggested donation at the door.
Duration: 90 minutes
Register Below:
This Art Therapy workshop was designed for women, especially mothers. Held in a nurturing environment as a non-judgmental space, where emotions are welcomed and honored. Over four sessions, we navigate the lunar phases like a sacred map. Through breathwork, intuitive movement, presence, and artistic engagement, we open a portal to genuine self-expression. Shared rituals and personal reflections support women in return to themselves, reclaiming their identity, creating time for themselves, holding agency from themselves, and building connections with others who might be on a similar path.
No artistic or astrological experience is needed, just a willingness to engage and feel
● #01 Full Moon – On the Surface | Soul Collage®
● #02 Waning Moon – A Dive into the Unconscious | Watercolor Flow
● #03 New Moon – Treasure Rising | Melted Wax Mandala
● #04 Waxing Moon – Nurture | Vessel in Clay
SOURCED VESSEL ART THERAPY WORKSHOP | ON THE SURFACE - SOUL COLLAGE
Sourced Vessel: Art Therapy Workshop
The Commons 2025
Free to attend, $20 suggested donation at the door.
Duration: 90 minutes
Register Below:
This Art Therapy workshop was designed for women, especially mothers. Held in a nurturing environment as a non-judgmental space, where emotions are welcomed and honored. Over four sessions, we navigate the lunar phases like a sacred map. Through breathwork, intuitive movement, presence, and artistic engagement, we open a portal to genuine self-expression. Shared rituals and personal reflections support women in return to themselves, reclaiming their identity, creating time for themselves, holding agency from themselves, and building connections with others who might be on a similar path.
No artistic or astrological experience is needed, just a willingness to engage and feel
● #01 Full Moon – On the Surface | Soul Collage®
● #02 Waning Moon – A Dive into the Unconscious | Watercolor Flow
● #03 New Moon – Treasure Rising | Melted Wax Mandala
● #04 Waxing Moon – Nurture | Vessel in Clay
LIGHT AND COLOR BY GARRY HARRIS
LIGHT AND COLOR
Works by Gary Harris
On Exhibit: through June 23
Opening Reception: Friday, June 13 | 5:00–7:00 PM
VISIT WEBSITE
INSTAGRAM
I am passionate about Impressionism, more specifically Claude Monet and other Paris-based artists from the early 1860s. I hope my oil paintings show the same respect for open composition with an emphasis on an accurate depiction of light in its changing qualities that is characterized by this 19th-century art movement. I have exhibited in Truro, MA at the Highland Museum and The Memorial Art Gallery, Rochester NY, at the Clothesline Show. My work is primarily focused on Cape Cod and Western NY landscapes, but I also enjoy doing still life paintings when I can not get outside to paint. Most recently I have been studying at the Cape School of Art in Provincetown, MA.
Mary Giammarino, Hilda Neily, John Clayton, and Anne Blair Brown are several of the artists that I have studied with.
“POWER, JOY, & RESILIENCE” CURATED BY IZZY BERDAN
POWER, JOY, & RESILIENCE”
Curated by Izzy Berdan
On Exhibit: through June 23
Opening Reception: Friday, June 13 | 5:00–7:00 PM
This show is featuring 6 queer and bipoc artists from across the country for our Juneteenth Celebration in Provincetown. Their work tells different stories of how they relate to both Juneteenth and the theme of this years festivities..."Power, Joy & Reslience". Join us for conversations through art and perspectives of beauty and the struggle.
HARMONY BY MARTHA FAGAN
HARMONY
Works by Martha Fagan
On Exhibit: through June 23
Opening Reception: Friday, June 13 | 5:00–7:00 PM
INSTAGRAM
I am a plein air Impressionist painter. I spend as much time as possible outdoors with my easel, palette knife, and oil paints. I try to capture the feeling in the moment, capturing the the shifting light and color. Nature has such variation in depth with intensity of colors. I am in love with the spectacular contrasts and harmonies of sand, sea, and sky and the glorious , brilliant light in Provincetown.
SPECIAL, An Award-Winning New Play & Film Project
SPECIAL, An Award-Winning New Play & Film Project
by Writer Director Producer Ann P Meredith
SCRIPTED PERFORMANCE
June 6th 2025 - 6:30-8:30 PM
Provincetown Commons A Collaborative Workspace for Artists
46 Bradford Street Provincetown, MA 02657
* All Welcome - Free and Open to the Public Produced by Swordfish Productions Pictures & Theatricals www.annpmeredith.com
On June 6th 2025 Provincetown Commons welcomes The internationally acclaimed Lesbian artist writer director producer Ann P Meredith and a Cast of Stellar Outer Cape Actors Anne Stott, Nat Taylor, Tamora Israel, Jen Zee, Sam Sewell and Loren Lee for a compelling Scripted Performance titled SPECIAL. An award-winning Theatrical Stage Script SPECIAL Swept the Audience Awards at The Fringe Festival and Was a Break-Out Hit at the New York, New WorkTheatre Festivals’ Broadway Showcase at The Duke
Swordfish Productions Pictures & Theatricals +1.917.806.9078 annpmeredith7@gmail.com specialfilm@gmail.com
Since January 1970 Swordfish Productions has been creating Social Impact Art, Photography, Film and Theatre to give a compassionate and realistic face and voice to people and cultures who have been injured, marginalized under-represented and therefore under-served
An acclaimed Feature Film Project
The Academy of Motion Pictures Arts & Sciences has already inducted SPECIAL's Screenplay
in to their Permanent Core Collection at The Margaret Herrick Library in Hollywood.
SPECIAL is also an award-winning Theatrical Stage Play sweeping the Audience Awards at The Fringe Festival and was a Break-Out Hit at the New York, New Work
Theatre Festivals’ Broadway Showcase at The Duke Theatre on 42nd Street.
Ann and her company Swordfish Productions Pictures & Theatricals’ goal is to film SPECIAL’s Motion Picture Feature Film in Provincetown qualifying for The OSCARS and The Golden Globes & the BAFTA Awards and taking SPECIAL to Broadway.
For more Information call 917.806.9078 or
eMail SPECIALFILM@gmail.com
SYMBIOTIC: NATURE WALK WITH LIVE PLANT MUSIC GUIDED BY ARIC ATTAS
Symbiotic: Nature Walk with Live Plant Music guided by Aric Attas
June 3 (rain date: June 4), 10 – 11:30am,
Beech Forest (meet in parking lot at 10)Registration required (12 max)
$25
Have you ever truly listened to the natural world? Join us for a mindful walk into the forest, where we’ll slow down, tune in, and experience the hidden soundscape of the natural world. Using custom-designed electronics, we’ll listen to the live electrical energy patterns within local plants transformed into rich, expressive musical sounds that reveal the forest in an entirely new way. During this event you will experience these living sounds blend seamlessly with a gentle guided meditation, to create an immersive, multi-sensory journey. Rooted in curiosity, this event invites you to a deeper connection with nature, one that awakens your sense of wonder and awe for the natural world around us as a living, breathing soundscape.
Aric Attas is an internationally recognized experimental sound artist. He is currently working on a series of data-driven sound installations incorporating generative ambient music, data input from the natural world, including plants, and collected field recordings. Each of his compositions tells a multi-dimensional story about a slice of our cosmos through data and sound. Blending science and art he invites us to reconnect with the beauty and mystery of the natural world with a sense of curiosity, wonder, and awe.
Participants, please wear comfortable shoes and clothes for a short walk, and bring a chair if you’d like to sit during the listening sessions.
Register Below:
This project is part of a new series in 2025 called From the Earth. Workshops will guide participants through exploring, recognizing, learning, and using the natural resources in abundance on Cape Cod. We'll focus on foraging, ink and paper making, and quiet observation of the fragile ecosystems that surround us. All workshops are artist-led with an emphasis on the human responsibility to protect and sustain our natural resources.
IN PLACE: WATERCOLOR MOMENTS by ROGER BRAIMON
Roger Braimon was professionally trained as a figurative artist in printmaking and photography at Cornell University (BFA) and oil painting at University of Pennsylvania (MFA). As a fabric colorist in the textile industry and later a graphic designer in beauty, he developed his interest in abstract color harmonies, patterns, and composition. His art progressed from oils, gouache, and collage to watercolors – landing on a medium that provides portability with the immediacy of impression. One of his driving interests is balancing unpredictability and precision in his depiction of familiar places in Provincetown and New York City.
photo by Graham Dickie